Search Antibody, Protein, and ELISA Kit Solutions

EHMT2 Antibody - N-terminal region (ARP32493_P050)

100 ul

Regular Price: $319.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP32493_P050-FITC Conjugated

ARP32493_P050-HRP Conjugated

ARP32493_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB, CHIP
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-145298 from Santa Cruz Biotechnology.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human EHMT2
Purification:
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 92%; Dog: 86%; Guinea Pig: 93%; Horse: 77%; Human: 100%; Mouse: 79%; Rabbit: 100%; Rat: 86%
Complete computational species homology data:
Anti-EHMT2 (ARP32493_P050)
Peptide Sequence:
Synthetic peptide located within the following region: VQSLAMRLLSMPGAQGAAAAGSEPPPATTSPEGQPKVHRARKTMSKPGNG
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-EHMT2 (ARP32493_P050) antibody is Catalog # AAP32493 (Previous Catalog # AAPP03492)
Datasheets/Manuals:
Printable datasheet for anti-EHMT2 (ARP32493_P050) antibody
Target Reference:
Kondo,Y., (er) PLoS ONE 3 (4), E2037 (2008)
Gene Symbol:
EHMT2
Official Gene Full Name:
Euchromatic histone-lysine N-methyltransferase 2
Alias Symbols:
BAT8, C6orf30, DKFZp686H08213, FLJ35547, G9A, KMT1C, NG36, NG36/G9a, GAT8
NCBI Gene Id:
10919
Protein Name:
Histone-lysine N-methyltransferase EHMT2
Description of Target:
A cluster of genes, BAT1-BAT5, has been localized in the vicinity of the genes for TNF alpha and TNF beta. This gene is found near this cluster; it was mapped near the gene for C2 within a 120-kb region that included a HSP70 gene pair. These genes are all within the human major histocompatibility complex class III region. This gene was thought to be two different genes, NG36 and G9a, adjacent to each other but a recent publication shows that there is only a single gene. The protein encoded by this gene is thought to be involved in intracellular protein-protein interaction.A cluster of genes, BAT1-BAT5, has been localized in the vicinity of the genes for TNF alpha and TNF beta. This gene is found near this cluster; it was mapped near the gene for C2 within a 120-kb region that included a HSP70 gene pair. These genes are all within the human major histocompatibility complex class III region. This gene was thought to be two different genes, NG36 and G9a, adjacent to each other but a recent publication shows that there is only a single gene. The protein encoded by this gene is thought to be involved in intracellular protein-protein interaction. There are three alternatively spliced transcript variants of this gene but only two are fully described.
Swissprot Id:
Q96KQ7
Protein Accession #:
NP_006700
Nucleotide Accession #:
NM_006709
Protein Size (# AA):
1210
Molecular Weight:
132kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express EHMT2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express EHMT2.
Protein Interactions:
PLOD3; NAA10; PSMA1; MX2; ITGB5; RD3; ZBTB38; ZNF785; NAPRT; FAM161A; KLF3; CHCHD2; C10orf12; DNMT1; PML; HIST2H3A; HIST1H1A; PRDM1; XAGE2; EED; RNF2; CTNNA3; SOX2; HDAC1; CBX5; CBX3; CBX1; REST; EHMT1; WIZ; MIER1; EHMT2; CDYL; UBC; HDAC2; HIST2H3C; CUX1;

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...