Size:100 ul
Special Price $229.00 Regular Price $319.00
In Stock
SKU
ARP32493_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP32493_P050-FITC Conjugated

ARP32493_P050-HRP Conjugated

ARP32493_P050-Biotin Conjugated

EHMT2 Antibody - N-terminal region (ARP32493_P050)

Catalog#: ARP32493_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB, CHIP
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-145298 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human EHMT2
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 92%; Dog: 86%; Guinea Pig: 93%; Horse: 77%; Human: 100%; Mouse: 79%; Rabbit: 100%; Rat: 86%
Complete computational species homology data Anti-EHMT2 (ARP32493_P050)
Peptide Sequence Synthetic peptide located within the following region: VQSLAMRLLSMPGAQGAAAAGSEPPPATTSPEGQPKVHRARKTMSKPGNG
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-EHMT2 (ARP32493_P050) antibody is Catalog # AAP32493 (Previous Catalog # AAPP03492)
Datasheets/Manuals Printable datasheet for anti-EHMT2 (ARP32493_P050) antibody
Target Reference Kondo,Y., (er) PLoS ONE 3 (4), E2037 (2008)
Gene Symbol EHMT2
Official Gene Full Name Euchromatic histone-lysine N-methyltransferase 2
Alias Symbols BAT8, C6orf30, DKFZp686H08213, FLJ35547, G9A, KMT1C, NG36, NG36/G9a, GAT8
NCBI Gene Id 10919
Protein Name Histone-lysine N-methyltransferase EHMT2
Description of Target A cluster of genes, BAT1-BAT5, has been localized in the vicinity of the genes for TNF alpha and TNF beta. This gene is found near this cluster; it was mapped near the gene for C2 within a 120-kb region that included a HSP70 gene pair. These genes are all within the human major histocompatibility complex class III region. This gene was thought to be two different genes, NG36 and G9a, adjacent to each other but a recent publication shows that there is only a single gene. The protein encoded by this gene is thought to be involved in intracellular protein-protein interaction.A cluster of genes, BAT1-BAT5, has been localized in the vicinity of the genes for TNF alpha and TNF beta. This gene is found near this cluster; it was mapped near the gene for C2 within a 120-kb region that included a HSP70 gene pair. These genes are all within the human major histocompatibility complex class III region. This gene was thought to be two different genes, NG36 and G9a, adjacent to each other but a recent publication shows that there is only a single gene. The protein encoded by this gene is thought to be involved in intracellular protein-protein interaction. There are three alternatively spliced transcript variants of this gene but only two are fully described.
Swissprot Id Q96KQ7
Protein Accession # NP_006700
Nucleotide Accession # NM_006709
Protein Size (# AA) 1210
Molecular Weight 132kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express EHMT2.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express EHMT2.
Protein Interactions PLOD3; NAA10; PSMA1; MX2; ITGB5; RD3; ZBTB38; ZNF785; NAPRT; FAM161A; KLF3; CHCHD2; C10orf12; DNMT1; PML; HIST2H3A; HIST1H1A; PRDM1; XAGE2; EED; RNF2; CTNNA3; SOX2; HDAC1; CBX5; CBX3; CBX1; REST; EHMT1; WIZ; MIER1; EHMT2; CDYL; UBC; HDAC2; HIST2H3C; CUX1;
  1. What is the species homology for "EHMT2 Antibody - N-terminal region (ARP32493_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat".

  2. How long will it take to receive "EHMT2 Antibody - N-terminal region (ARP32493_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "EHMT2 Antibody - N-terminal region (ARP32493_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "EHMT2 Antibody - N-terminal region (ARP32493_P050)"?

    This target may also be called "BAT8, C6orf30, DKFZp686H08213, FLJ35547, G9A, KMT1C, NG36, NG36/G9a, GAT8" in publications.

  5. What is the shipping cost for "EHMT2 Antibody - N-terminal region (ARP32493_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "EHMT2 Antibody - N-terminal region (ARP32493_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "EHMT2 Antibody - N-terminal region (ARP32493_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "132kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "EHMT2 Antibody - N-terminal region (ARP32493_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "EHMT2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "EHMT2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "EHMT2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "EHMT2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "EHMT2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "EHMT2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:EHMT2 Antibody - N-terminal region (ARP32493_P050)
Your Rating
We found other products you might like!