EHF Antibody - C-terminal region (ARP89726_P050)

Catalog No: ARP89726_P050

Host: Rabbit
Target Name: EHF
Sample Tissue: Mouse Kidney lysates
Antibody Dilution: 1ug/ml

Product Info

• Predicted Species Reactivity: Mouse
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of mouse EHF
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: KKKNNSSMTYEKLSRAMRYYYKREILERVDGRRLVYKFGKNARGWRENEN
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-EHF (ARP89726_P050) antibody is Catalog # AAP89726

Target Info

• Gene Symbol: EHF
• Gene Full Name: ets homologous factor
• Alias Symbols: AU019492, 9030625L19Rik
• NCBI Gene Id: 13661
• Protein Name: ETS homologous factor
• Description of Target: Transcriptional activator that may play a role in regulating epithelial cell differentiation and proliferation. May act as a repressor for a specific subset of ETS/AP-1-responsive genes, and as a modulator of the nuclear response to mitogen-activated protein kinase signaling cascades. Binds to DNA sequences containing the consensus nucleotide core sequence GGAA. Involved in regulation of TNFRSF10B/DR5 expression through Ets-binding sequences on the TNFRSF10B/DR5 promoter (By similarity).
• Uniprot ID: O70273-2
• Protein Accession #: NP_031940.1
• Nucleotide Accession #: NM_007914.3
• Protein Size (# AA): 285
• Molecular Weight: 31 kDa