Search Antibody, Protein, and ELISA Kit Solutions

EHD1 Antibody - middle region (ARP89824_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
EHD1
Official Gene Full Name:
EH-domain containing 1
NCBI Gene Id:
13660
Protein Name:
EH domain-containing protein 1
Swissprot Id:
Q9WVK4
Protein Accession #:
NP_034249.1
Nucleotide Accession #:
NM_010119.5
Alias Symbols:
Past1, RME-1, AA409636
Description of Target:
ATP- and membrane-binding protein that controls membrane reorganization/tubulation upon ATP hydrolysis. In vitro causes vesiculation of endocytic membranes (By similarity). Acts in early endocytic membrane fusion and membrane trafficking of recycling endosomes. Recruited to endosomal membranes upon nerve growth factor stimulation, indirectly regulates neurite outgrowth (By similarity). Plays a role in myoblast fusion. Involved in the unidirectional retrograde dendritic transport of endocytosed BACE1 and in efficient sorting of BACE1 to axons implicating a function in neuronal APP processing. Plays a role in the formation of the ciliary vesicle (CV), an early step in cilium biogenesis. Proposed to be required for the fusion of distal appendage vesicles (DAVs) to form the CV by recruiting SNARE complex component SNAP29. Is required for recruitment of transition zone proteins CEP290, RPGRIP1L, TMEM67 and B9D2, and of IFT20 following DAV reorganization before Rab8-dependent ciliary membrane extension. Required for the loss of CCP110 form the mother centriole essential for the maturation of the basal body during ciliogenesis (By similarity).
Protein Size (# AA):
534
Molecular Weight:
61 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express EHD1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express EHD1.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of mouse EHD1
Predicted Species Reactivity:
Mouse
Peptide Sequence:
Synthetic peptide located within the following region: MPSQAVKGGAFDGTMNGPFGHGYGEGAGEGIDDVEWVVGKDKPTYDEIFY
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-EHD1 (ARP89824_P050) antibody is Catalog # AAP89824
Datasheets/Manuals:
Printable datasheet for anti-EHD1 (ARP89824_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...