Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP89824_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

EHD1 Antibody - middle region (ARP89824_P050)

Catalog#: ARP89824_P050
Domestic: within 24 hours delivery | International: 3-5 business days
More Information
Predicted Species ReactivityMouse
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of mouse EHD1
PurificationAffinity purified
Peptide SequenceSynthetic peptide located within the following region: MPSQAVKGGAFDGTMNGPFGHGYGEGAGEGIDDVEWVVGKDKPTYDEIFY
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-EHD1 (ARP89824_P050) antibody is Catalog # AAP89824
Datasheets/ManualsPrintable datasheet for anti-EHD1 (ARP89824_P050) antibody
Gene SymbolEHD1
Official Gene Full NameEH-domain containing 1
Alias SymbolsPast1, RME-1, AA409636
NCBI Gene Id13660
Protein NameEH domain-containing protein 1
Description of TargetATP- and membrane-binding protein that controls membrane reorganization/tubulation upon ATP hydrolysis. In vitro causes vesiculation of endocytic membranes (By similarity). Acts in early endocytic membrane fusion and membrane trafficking of recycling endosomes. Recruited to endosomal membranes upon nerve growth factor stimulation, indirectly regulates neurite outgrowth (By similarity). Plays a role in myoblast fusion. Involved in the unidirectional retrograde dendritic transport of endocytosed BACE1 and in efficient sorting of BACE1 to axons implicating a function in neuronal APP processing. Plays a role in the formation of the ciliary vesicle (CV), an early step in cilium biogenesis. Proposed to be required for the fusion of distal appendage vesicles (DAVs) to form the CV by recruiting SNARE complex component SNAP29. Is required for recruitment of transition zone proteins CEP290, RPGRIP1L, TMEM67 and B9D2, and of IFT20 following DAV reorganization before Rab8-dependent ciliary membrane extension. Required for the loss of CCP110 form the mother centriole essential for the maturation of the basal body during ciliogenesis (By similarity).
Swissprot IdQ9WVK4
Protein Accession #NP_034249.1
Nucleotide Accession #NM_010119.5
Protein Size (# AA)534
Molecular Weight61 kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express EHD1.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express EHD1.
Write Your Own Review
You're reviewing:EHD1 Antibody - middle region (ARP89824_P050)
Your Rating
Aviva Pathways
Aviva Tissue Tool
Aviva Blast Tool
Aviva Tips and Tricks