Search Antibody, Protein, and ELISA Kit Solutions

EGR2 Antibody - middle region : FITC (ARP72379_P050-FITC)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP72379_P050 Unconjugated

ARP72379_P050-HRP Conjugated

ARP72379_P050-Biotin Conjugated

Gene Symbol:
EGR2
NCBI Gene Id:
1959
Swissprot Id:
P11161-2
Protein Accession #:
NP_001129651
Alias Symbols:
EGR2, KROX20,
Replacement Item:
This antibody may replace item sc-20450 from Santa Cruz Biotechnology.
Description of Target:
The protein encoded by this gene is a transcription factor with three tandem C2H2-type zinc fingers. Defects in this gene are associated with Charcot-Marie-Tooth disease type 1D (CMT1D), Charcot-Marie-Tooth disease type 4E (CMT4E), and with Dejerine-Sottas syndrome (DSS). Multiple transcript variants encoding two different isoforms have been found for this gene.
Protein Size (# AA):
426
Molecular Weight:
46kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express EGR2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express EGR2.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of Human EGR2
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: DPGLFPMIPDYPGFFPSQCQRDLHGTAGPDRKPFPCPLDTLRVPPPLTPL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
0.5 mg/ml
Protein Interactions:
RPL7L1; HN1L; RIMKLB; RBM15B; NDUFS2; BPGM; SRA1; DTX1; WWP2; UBC; UBE2I; NAB2; SOX8; MED31; SOX10; HCFC1; ACP5; NFATC1; FASLG;
Blocking Peptide:
For anti-EGR2 (ARP72379_P050-FITC) antibody is Catalog # AAP72379
Datasheets/Manuals:
Printable datasheet for anti-EGR2 (ARP72379_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...