Size:100 ul
$319.00
In Stock
SKU
P100880_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

P100880_P050-FITC Conjugated

P100880_P050-HRP Conjugated

P100880_P050-Biotin Conjugated

More Information
Tested Species Reactivity Human, Mouse, Rat
Predicted Species Reactivity Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC-P, IHC-F, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-20450 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human EGR2
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 92%; Horse: 85%; Human: 100%; Mouse: 100%; Pig: 92%; Rabbit: 92%; Rat: 92%
Complete computational species homology data Anti-EGR2 (P100880_P050)
Peptide Sequence Synthetic peptide located within the following region: PFACDYCGRKFARSDERKRHTKIHLRQKERKSSAPSASVPAPSTASCSGG
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-EGR2 (P100880_P050) antibody is Catalog # AAP31178 (Previous Catalog # AAPP01921)
Datasheets/Manuals Printable datasheet for anti-EGR2 (P100880_P050) antibody
Target Reference Yoo,Y.G., et al., (2004) J. Biol. Chem. 279 (35), 36242-36249
Publications

Damm, F. et al. Acquired initiating mutations in early hematopoietic cells of CLL patients. Cancer Discov. 4, 1088-101 (2014). IHC, WB, Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat 24920063

Lagrange, B. et al. A role for miR-142-3p in colony-stimulating factor 1-induced monocyte differentiation into macrophages. Biochim. Biophys. Acta 1833, 1936-46 (2013). IHC, WB, Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat 23602969

Latasa, M.-J., Ituero, M., Moran-Gonzalez, A., Aranda, A. & Cosgaya, J. M. Retinoic acid regulates myelin formation in the peripheral nervous system. Glia 58, 1451-64 (2010). IHC, WB, Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat 20648638

Gene Symbol EGR2
Official Gene Full Name Early growth response 2
Alias Symbols CMT1D, CMT4E, DKFZp686J1957, FLJ14547, KROX20, AT591
NCBI Gene Id 1959
Protein Name E3 SUMO-protein ligase EGR2
Description of Target The early growth response protein 2 (EGR2) is a transcription factor with three tandem C2H2-type zinc fingers. Mutations in this gene are associated with the autosomal dominant Charcot-Marie-Tooth disease, type 1.The early growth response protein 2 is a transcription factor with three tandem C2H2-type zinc fingers. Mutations in this gene are associated with the autosomal dominant Charcot-Marie-Tooth disease, type 1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot Id P11161
Protein Accession # NP_000390
Nucleotide Accession # NM_000399
Protein Size (# AA) 476
Molecular Weight 50kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express EGR2.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express EGR2.
Protein Interactions RPL7L1; HN1L; RIMKLB; RBM15B; NDUFS2; BPGM; SRA1; DTX1; WWP2; UBC; UBE2I; NAB2; SOX8; MED31; SOX10; HCFC1; ACP5; NFATC1; FASLG;
  1. What is the species homology for "EGR2 Antibody - C-terminal region (P100880_P050)"?

    The tested species reactivity for this item is "Human, Mouse, Rat". This antibody is predicted to have homology to "Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat".

  2. How long will it take to receive "EGR2 Antibody - C-terminal region (P100880_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "EGR2 Antibody - C-terminal region (P100880_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "EGR2 Antibody - C-terminal region (P100880_P050)"?

    This target may also be called "CMT1D, CMT4E, DKFZp686J1957, FLJ14547, KROX20, AT591" in publications.

  5. What is the shipping cost for "EGR2 Antibody - C-terminal region (P100880_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "EGR2 Antibody - C-terminal region (P100880_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "EGR2 Antibody - C-terminal region (P100880_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "50kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "EGR2 Antibody - C-terminal region (P100880_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "EGR2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "EGR2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "EGR2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "EGR2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "EGR2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "EGR2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:EGR2 Antibody - C-terminal region (P100880_P050)
Your Rating
We found other products you might like!