Catalog No: P100880_P050
Price: $0.00
SKU
P100880_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-EGR2 (P100880_P050) antibody
Product Info
Tested Species ReactivityHuman, Mouse, Rat
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC-P, IHC-F, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human EGR2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 92%; Horse: 85%; Human: 100%; Mouse: 100%; Pig: 92%; Rabbit: 92%; Rat: 92%
Peptide SequenceSynthetic peptide located within the following region: PFACDYCGRKFARSDERKRHTKIHLRQKERKSSAPSASVPAPSTASCSGG
Concentration0.5 mg/ml
Blocking PeptideFor anti-EGR2 (P100880_P050) antibody is Catalog # AAP31178 (Previous Catalog # AAPP01921)
ReferenceYoo,Y.G., et al., (2004) J. Biol. Chem. 279 (35), 36242-36249
Publications

Damm, F. et al. Acquired initiating mutations in early hematopoietic cells of CLL patients. Cancer Discov. 4, 1088-101 (2014). 24920063

Lagrange, B. et al. A role for miR-142-3p in colony-stimulating factor 1-induced monocyte differentiation into macrophages. Biochim. Biophys. Acta 1833, 1936-46 (2013). 23602969

Latasa, M.-J., Ituero, M., Moran-Gonzalez, A., Aranda, A. & Cosgaya, J. M. Retinoic acid regulates myelin formation in the peripheral nervous system. Glia 58, 1451-64 (2010). 20648638

Gene SymbolEGR2
Gene Full NameEarly growth response 2
Alias SymbolsCHN1, AT591, CMT1D, CMT4E, KROX20
NCBI Gene Id1959
Protein NameE3 SUMO-protein ligase EGR2
Description of TargetThe early growth response protein 2 (EGR2) is a transcription factor with three tandem C2H2-type zinc fingers. Mutations in this gene are associated with the autosomal dominant Charcot-Marie-Tooth disease, type 1.The early growth response protein 2 is a transcription factor with three tandem C2H2-type zinc fingers. Mutations in this gene are associated with the autosomal dominant Charcot-Marie-Tooth disease, type 1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Uniprot IDP11161
Protein Accession #NP_000390
Nucleotide Accession #NM_000399
Protein Size (# AA)476
Molecular Weight50kDa
Protein InteractionsRPL7L1; HN1L; RIMKLB; RBM15B; NDUFS2; BPGM; SRA1; DTX1; WWP2; UBC; UBE2I; NAB2; SOX8; MED31; SOX10; HCFC1; ACP5; NFATC1; FASLG;
  1. What is the species homology for "EGR2 Antibody - C-terminal region (P100880_P050)"?

    The tested species reactivity for this item is "Human, Mouse, Rat". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit".

  2. How long will it take to receive "EGR2 Antibody - C-terminal region (P100880_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "EGR2 Antibody - C-terminal region (P100880_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "EGR2 Antibody - C-terminal region (P100880_P050)"?

    This target may also be called "CHN1, AT591, CMT1D, CMT4E, KROX20" in publications.

  5. What is the shipping cost for "EGR2 Antibody - C-terminal region (P100880_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "EGR2 Antibody - C-terminal region (P100880_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "EGR2 Antibody - C-terminal region (P100880_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "50kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "EGR2 Antibody - C-terminal region (P100880_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "EGR2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "EGR2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "EGR2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "EGR2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "EGR2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "EGR2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:EGR2 Antibody - C-terminal region (P100880_P050)
Your Rating
We found other products you might like!