Size:100 ul
$319.00
In stock
SKU
P100880_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

P100880_P050-FITC Conjugated

P100880_P050-HRP Conjugated

P100880_P050-Biotin Conjugated

EGR2 Antibody - C-terminal region (P100880_P050)

Rating:
60% of 100
Catalog#: P100880_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species ReactivityHuman, Mouse, Rat
Predicted Species ReactivityCow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC-P, IHC-F, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-20450 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human EGR2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 92%; Horse: 85%; Human: 100%; Mouse: 100%; Pig: 92%; Rabbit: 92%; Rat: 92%
Complete computational species homology dataAnti-EGR2 (P100880_P050)
Peptide SequenceSynthetic peptide located within the following region: PFACDYCGRKFARSDERKRHTKIHLRQKERKSSAPSASVPAPSTASCSGG
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-EGR2 (P100880_P050) antibody is Catalog # AAP31178 (Previous Catalog # AAPP01921)
Datasheets/ManualsPrintable datasheet for anti-EGR2 (P100880_P050) antibody
Target ReferenceYoo,Y.G., et al., (2004) J. Biol. Chem. 279 (35), 36242-36249
Publications

Damm, F. et al. Acquired initiating mutations in early hematopoietic cells of CLL patients. Cancer Discov. 4, 1088-101 (2014). IHC, WB, Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat 24920063

Lagrange, B. et al. A role for miR-142-3p in colony-stimulating factor 1-induced monocyte differentiation into macrophages. Biochim. Biophys. Acta 1833, 1936-46 (2013). IHC, WB, Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat 23602969

Latasa, M.-J., Ituero, M., Moran-Gonzalez, A., Aranda, A. & Cosgaya, J. M. Retinoic acid regulates myelin formation in the peripheral nervous system. Glia 58, 1451-64 (2010). IHC, WB, Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat 20648638

Gene SymbolEGR2
Official Gene Full NameEarly growth response 2
Alias SymbolsCMT1D, CMT4E, DKFZp686J1957, FLJ14547, KROX20, AT591
NCBI Gene Id1959
Protein NameE3 SUMO-protein ligase EGR2
Description of TargetThe early growth response protein 2 (EGR2) is a transcription factor with three tandem C2H2-type zinc fingers. Mutations in this gene are associated with the autosomal dominant Charcot-Marie-Tooth disease, type 1.The early growth response protein 2 is a transcription factor with three tandem C2H2-type zinc fingers. Mutations in this gene are associated with the autosomal dominant Charcot-Marie-Tooth disease, type 1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot IdP11161
Protein Accession #NP_000390
Nucleotide Accession #NM_000399
Protein Size (# AA)476
Molecular Weight50kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express EGR2.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express EGR2.
Protein InteractionsRPL7L1; HN1L; RIMKLB; RBM15B; NDUFS2; BPGM; SRA1; DTX1; WWP2; UBC; UBE2I; NAB2; SOX8; MED31; SOX10; HCFC1; ACP5; NFATC1; FASLG;
Write Your Own Review
You're reviewing:EGR2 Antibody - C-terminal region (P100880_P050)
Your Rating
Aviva HIS tag Deal
Free Microscope
Aviva Validation Data
Aviva Live Chat