- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for anti-EGR1 (ARP32241_P050-FITC) antibody |
---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Horse, Pig, Rabbit |
---|---|
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
Clonality | Polyclonal |
Host | Rabbit |
Conjugation | FITC: Fluorescein Isothiocyanate |
Application | IHC, WB |
Additional Information | IHC Information: Human Colon, Myenteric Plexus: Formalin-Fixed, Paraffin-Embedded (FFPE) |
Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human EGR1 |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Cow: 87%; Horse: 93%; Human: 100%; Mouse: 86%; Pig: 100%; Rabbit: 86%; Rat: 93% |
Peptide Sequence | Synthetic peptide located within the following region: DNYPKLEEMMLLSNGAPQFLGAAGAPEGSGSNSSSSSSGGGGGGGGGSNS |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-EGR1 (ARP32241_P050-FITC) antibody is Catalog # AAP32241 (Previous Catalog # AAPP03222) |
Reference | Yu,J., et al., (2004) Mol.Cell 15(1),83-94 |
Publications | Wenzel, K. et al. Expression of the protein phosphatase 1 inhibitor KEPI is downregulated in breast cancer cell lines and tissues and involved in the regulation of the tumor suppressor EGR1 via the MEK-ERK pathway. Biol. Chem. 388, 489-95 (2007). WB, Human, Pig, Horse, Rat, Bovine, Rabbit, Mouse 17516844 Jaluria, P., Konstantopoulos, K., Betenbaugh, M. & Shiloach, J. Egr1 and Gas6 facilitate the adaptation of HEK-293 cells to serum-free media by conferring enhanced viability and higher growth rates. Biotechnol. Bioeng. 99, 1443-52 (2008). WB, Human, Pig, Horse, Rat, Bovine, Rabbit, Mouse 18023050 Tennis, M. A. et al. Prostacyclin inhibits non-small cell lung cancer growth by a frizzled 9-dependent pathway that is blocked by secreted frizzled-related protein 1. Neoplasia 12, 244-53 (2010). ICC/IF, Human, Pig, Horse, Rat, Bovine, Rabbit, Mouse 20368707 Ohata, Y. et al. Elevated fibroblast growth factor 23 exerts its effects on placenta and regulates vitamin D metabolism in pregnancy of Hyp mice. J. Bone Miner. Res. 29, 1627-38 (2014). IHC, Human, Pig, Horse, Rat, Bovine, Rabbit, Mouse 24470103 Barbolina, M. V, Adley, B. P., Ariztia, E. V, Liu, Y. & Stack, M. S. Microenvironmental regulation of membrane type 1 matrix metalloproteinase activity in ovarian carcinoma cells via collagen-induced EGR1 expression. J. Biol. Chem. 282, 4924-31 (2007). WB, Human, Pig, Horse, Rat, Bovine, Rabbit, Mouse 17158885 |
Gene Symbol | EGR1 |
---|---|
Gene Full Name | Early growth response 1 |
Alias Symbols | TIS8, AT225, G0S30, NGFI-A, ZNF225, KROX-24, ZIF-268 |
NCBI Gene Id | 1958 |
Protein Name | Early growth response protein 1 |
Description of Target | Early Growth Response Protein 1 (EGR1, Krox-24 protein, nerve growth factor-induced protein A, Transcription factor ETR103, Zinc finger protein 225) belongs to the EGR family of C2H2-type zinc-finger proteins. It is a nuclear protein and functions as a transcriptional regulator. The products of target genes it activates are required for differentitation and mitogenesis. Studies suggest this is a cancer suppresor gene. The protein encoded by this gene belongs to the EGR family of C2H2-type zinc-finger proteins. It is a nuclear protein and functions as a transcriptional regulator. The products of target genes it activates are required for differentitation and mitogenesis. Studies suggest this is a cancer suppresor gene. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
Uniprot ID | P18146 |
Protein Accession # | NP_001955 |
Nucleotide Accession # | NM_001964 |
Protein Size (# AA) | 543 |
Molecular Weight | 57kDa |
Protein Interactions | CEBPB; WT1; SUMO1; TP53; MDM2; EP300; CDKN2A; SRA1; IL1B; PTEN; SP1; SNAI1; TBX2; PFDN5; SREBF2; ERBB3; NAB2; PITX1; NAB1; NFATC2; CREBBP; PSMA3; JUN; RELA; CSNK2A1; NFATC1; GADD45B; GADD45A; |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "EGR1 Antibody - N-terminal region : FITC (ARP32241_P050-FITC)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Horse, Pig, Rabbit".
-
How long will it take to receive "EGR1 Antibody - N-terminal region : FITC (ARP32241_P050-FITC)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "EGR1 Antibody - N-terminal region : FITC (ARP32241_P050-FITC)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "EGR1 Antibody - N-terminal region : FITC (ARP32241_P050-FITC)"?
This target may also be called "TIS8, AT225, G0S30, NGFI-A, ZNF225, KROX-24, ZIF-268" in publications.
-
What is the shipping cost for "EGR1 Antibody - N-terminal region : FITC (ARP32241_P050-FITC)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "EGR1 Antibody - N-terminal region : FITC (ARP32241_P050-FITC)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "EGR1 Antibody - N-terminal region : FITC (ARP32241_P050-FITC)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "57kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "EGR1 Antibody - N-terminal region : FITC (ARP32241_P050-FITC)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "EGR1"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "EGR1"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "EGR1"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "EGR1"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "EGR1"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "EGR1"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.