SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP32241_P050-Biotin
Size:100ul
Price: $434.00
SKU
ARP32241_P050-Biotin
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

EGR1 Antibody - N-terminal region : Biotin (ARP32241_P050-Biotin)

Datasheets/ManualsPrintable datasheet for anti-EGR1 (ARP32241_P050-Biotin) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Horse, Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationBiotin
ApplicationIHC, WB
Additional InformationIHC Information: Human Colon, Myenteric Plexus: Formalin-Fixed, Paraffin-Embedded (FFPE)
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human EGR1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 87%; Horse: 93%; Human: 100%; Mouse: 86%; Pig: 100%; Rabbit: 86%; Rat: 93%
Peptide SequenceSynthetic peptide located within the following region: DNYPKLEEMMLLSNGAPQFLGAAGAPEGSGSNSSSSSSGGGGGGGGGSNS
Concentration0.5 mg/ml
Blocking PeptideFor anti-EGR1 (ARP32241_P050-Biotin) antibody is Catalog # AAP32241 (Previous Catalog # AAPP03222)
ReferenceYu,J., et al., (2004) Mol.Cell 15(1),83-94
Publications

Wenzel, K. et al. Expression of the protein phosphatase 1 inhibitor KEPI is downregulated in breast cancer cell lines and tissues and involved in the regulation of the tumor suppressor EGR1 via the MEK-ERK pathway. Biol. Chem. 388, 489-95 (2007). WB, Human, Pig, Horse, Rat, Bovine, Rabbit, Mouse 17516844

Jaluria, P., Konstantopoulos, K., Betenbaugh, M. & Shiloach, J. Egr1 and Gas6 facilitate the adaptation of HEK-293 cells to serum-free media by conferring enhanced viability and higher growth rates. Biotechnol. Bioeng. 99, 1443-52 (2008). WB, Human, Pig, Horse, Rat, Bovine, Rabbit, Mouse 18023050

Tennis, M. A. et al. Prostacyclin inhibits non-small cell lung cancer growth by a frizzled 9-dependent pathway that is blocked by secreted frizzled-related protein 1. Neoplasia 12, 244-53 (2010). ICC/IF, Human, Pig, Horse, Rat, Bovine, Rabbit, Mouse 20368707

Ohata, Y. et al. Elevated fibroblast growth factor 23 exerts its effects on placenta and regulates vitamin D metabolism in pregnancy of Hyp mice. J. Bone Miner. Res. 29, 1627-38 (2014). IHC, Human, Pig, Horse, Rat, Bovine, Rabbit, Mouse 24470103

Barbolina, M. V, Adley, B. P., Ariztia, E. V, Liu, Y. & Stack, M. S. Microenvironmental regulation of membrane type 1 matrix metalloproteinase activity in ovarian carcinoma cells via collagen-induced EGR1 expression. J. Biol. Chem. 282, 4924-31 (2007). WB, Human, Pig, Horse, Rat, Bovine, Rabbit, Mouse 17158885

Gene SymbolEGR1
Gene Full NameEarly growth response 1
Alias SymbolsTIS8, AT225, G0S30, NGFI-A, ZNF225, KROX-24, ZIF-268
NCBI Gene Id1958
Protein NameEarly growth response protein 1
Description of TargetEarly Growth Response Protein 1 (EGR1, Krox-24 protein, nerve growth factor-induced protein A, Transcription factor ETR103, Zinc finger protein 225) belongs to the EGR family of C2H2-type zinc-finger proteins. It is a nuclear protein and functions as a transcriptional regulator. The products of target genes it activates are required for differentitation and mitogenesis. Studies suggest this is a cancer suppresor gene. The protein encoded by this gene belongs to the EGR family of C2H2-type zinc-finger proteins. It is a nuclear protein and functions as a transcriptional regulator. The products of target genes it activates are required for differentitation and mitogenesis. Studies suggest this is a cancer suppresor gene. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Uniprot IDP18146
Protein Accession #NP_001955
Nucleotide Accession #NM_001964
Protein Size (# AA)543
Molecular Weight57kDa
Protein InteractionsCEBPB; WT1; SUMO1; TP53; MDM2; EP300; CDKN2A; SRA1; IL1B; PTEN; SP1; SNAI1; TBX2; PFDN5; SREBF2; ERBB3; NAB2; PITX1; NAB1; NFATC2; CREBBP; PSMA3; JUN; RELA; CSNK2A1; NFATC1; GADD45B; GADD45A;
  1. What is the species homology for "EGR1 Antibody - N-terminal region : Biotin (ARP32241_P050-Biotin)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Horse, Pig, Rabbit".

  2. How long will it take to receive "EGR1 Antibody - N-terminal region : Biotin (ARP32241_P050-Biotin)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "EGR1 Antibody - N-terminal region : Biotin (ARP32241_P050-Biotin)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "EGR1 Antibody - N-terminal region : Biotin (ARP32241_P050-Biotin)"?

    This target may also be called "TIS8, AT225, G0S30, NGFI-A, ZNF225, KROX-24, ZIF-268" in publications.

  5. What is the shipping cost for "EGR1 Antibody - N-terminal region : Biotin (ARP32241_P050-Biotin)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "EGR1 Antibody - N-terminal region : Biotin (ARP32241_P050-Biotin)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "EGR1 Antibody - N-terminal region : Biotin (ARP32241_P050-Biotin)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "57kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "EGR1 Antibody - N-terminal region : Biotin (ARP32241_P050-Biotin)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "EGR1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "EGR1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "EGR1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "EGR1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "EGR1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "EGR1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:EGR1 Antibody - N-terminal region : Biotin (ARP32241_P050-Biotin)
Your Rating
We found other products you might like!