Size:100 ul
Special Price $229.00 Regular Price $319.00
In Stock
SKU
ARP32241_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP32241_P050-FITC Conjugated

ARP32241_P050-HRP Conjugated

ARP32241_P050-Biotin Conjugated

More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Horse, Human, Mouse, Pig, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Additional Information IHC Information: Human Colon, Myenteric Plexus: Formalin-Fixed, Paraffin-Embedded (FFPE)
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-101033 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human EGR1
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 87%; Horse: 93%; Human: 100%; Mouse: 86%; Pig: 100%; Rabbit: 86%; Rat: 93%
Complete computational species homology data Anti-EGR1 (ARP32241_P050)
Peptide Sequence Synthetic peptide located within the following region: DNYPKLEEMMLLSNGAPQFLGAAGAPEGSGSNSSSSSSGGGGGGGGGSNS
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-EGR1 (ARP32241_P050) antibody is Catalog # AAP32241 (Previous Catalog # AAPP03222)
Datasheets/Manuals Printable datasheet for anti-EGR1 (ARP32241_P050) antibody
Target Reference Yu,J., et al., (2004) Mol.Cell 15(1),83-94
Publications

Balakrishnan, A; Stykel, MG; Touahri, Y; Stratton, JA; Biernaskie, J; Schuurmans, C; Temporal Analysis of Gene Expression in the Murine Schwann Cell Lineage and the Acutely Injured Postnatal Nerve. 11, e0153256 (2016). IHC, WB, Cow, Horse, Human, Mouse, Pig, Rabbit, Rat 27058953

Barbolina, M. V, Adley, B. P., Ariztia, E. V, Liu, Y. & Stack, M. S. Microenvironmental regulation of membrane type 1 matrix metalloproteinase activity in ovarian carcinoma cells via collagen-induced EGR1 expression. J. Biol. Chem. 282, 4924-31 (2007). IHC, WB, Cow, Horse, Human, Mouse, Pig, Rabbit, Rat 17158885

Jaluria, P., Konstantopoulos, K., Betenbaugh, M. & Shiloach, J. Egr1 and Gas6 facilitate the adaptation of HEK-293 cells to serum-free media by conferring enhanced viability and higher growth rates. Biotechnol. Bioeng. 99, 1443-52 (2008). IHC, WB, Cow, Horse, Human, Mouse, Pig, Rabbit, Rat 18023050

Lane, K. R. et al. Cell cycle-regulated protein abundance changes in synchronously proliferating HeLa cells include regulation of pre-mRNA splicing proteins. PLoS One 8, e58456 (2013). IHC, WB, Cow, Horse, Human, Mouse, Pig, Rabbit, Rat 23520512

Ohata, Y. et al. Elevated fibroblast growth factor 23 exerts its effects on placenta and regulates vitamin D metabolism in pregnancy of Hyp mice. J. Bone Miner. Res. 29, 1627-38 (2014). IHC, WB, Cow, Horse, Human, Mouse, Pig, Rabbit, Rat 24470103

Tennis, M. A. et al. Prostacyclin inhibits non-small cell lung cancer growth by a frizzled 9-dependent pathway that is blocked by secreted frizzled-related protein 1. Neoplasia 12, 244-53 (2010). IHC, WB, Cow, Horse, Human, Mouse, Pig, Rabbit, Rat 20368707

Wenzel, K. et al. Expression of the protein phosphatase 1 inhibitor KEPI is downregulated in breast cancer cell lines and tissues and involved in the regulation of the tumor suppressor EGR1 via the MEK-ERK pathway. Biol. Chem. 388, 489-95 (2007). IHC, WB, Cow, Horse, Human, Mouse, Pig, Rabbit, Rat 17516844

Gene Symbol EGR1
Official Gene Full Name Early growth response 1
Alias Symbols AT225, G0S30, KROX-24, NGFI-A, TIS8, ZIF-268, ZNF225
NCBI Gene Id 1958
Protein Name Early growth response protein 1
Description of Target Early Growth Response Protein 1 (EGR1, Krox-24 protein, nerve growth factor-induced protein A, Transcription factor ETR103, Zinc finger protein 225) belongs to the EGR family of C2H2-type zinc-finger proteins. It is a nuclear protein and functions as a transcriptional regulator. The products of target genes it activates are required for differentitation and mitogenesis. Studies suggest this is a cancer suppresor gene. The protein encoded by this gene belongs to the EGR family of C2H2-type zinc-finger proteins. It is a nuclear protein and functions as a transcriptional regulator. The products of target genes it activates are required for differentitation and mitogenesis. Studies suggest this is a cancer suppresor gene. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot Id P18146
Protein Accession # NP_001955
Nucleotide Accession # NM_001964
Protein Size (# AA) 543
Molecular Weight 57kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express EGR1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express EGR1.
Protein Interactions CEBPB; WT1; SUMO1; TP53; MDM2; EP300; CDKN2A; SRA1; IL1B; PTEN; SP1; SNAI1; TBX2; PFDN5; SREBF2; ERBB3; NAB2; PITX1; NAB1; NFATC2; CREBBP; PSMA3; JUN; RELA; CSNK2A1; NFATC1; GADD45B; GADD45A;
  1. What is the species homology for "EGR1 Antibody - N-terminal region (ARP32241_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Horse, Human, Mouse, Pig, Rabbit, Rat".

  2. How long will it take to receive "EGR1 Antibody - N-terminal region (ARP32241_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "EGR1 Antibody - N-terminal region (ARP32241_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "EGR1 Antibody - N-terminal region (ARP32241_P050)"?

    This target may also be called "AT225, G0S30, KROX-24, NGFI-A, TIS8, ZIF-268, ZNF225" in publications.

  5. What is the shipping cost for "EGR1 Antibody - N-terminal region (ARP32241_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "EGR1 Antibody - N-terminal region (ARP32241_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "EGR1 Antibody - N-terminal region (ARP32241_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "57kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "EGR1 Antibody - N-terminal region (ARP32241_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "EGR1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "EGR1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "EGR1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "EGR1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "EGR1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "EGR1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:EGR1 Antibody - N-terminal region (ARP32241_P050)
Your Rating