Search Antibody, Protein, and ELISA Kit Solutions

EGR1 antibody - N-terminal region (ARP32241_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP32241_P050-FITC Conjugated

ARP32241_P050-HRP Conjugated

ARP32241_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Early growth response 1
Protein Name:
Early growth response protein 1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
AT225, G0S30, KROX-24, NGFI-A, TIS8, ZIF-268, ZNF225
Replacement Item:
This antibody may replace item sc-101033 from Santa Cruz Biotechnology.
Description of Target:
Early Growth Response Protein 1 (EGR1, Krox-24 protein, nerve growth factor-induced protein A, Transcription factor ETR103, Zinc finger protein 225) belongs to the EGR family of C2H2-type zinc-finger proteins. It is a nuclear protein and functions as a transcriptional regulator. The products of target genes it activates are required for differentitation and mitogenesis. Studies suggest this is a cancer suppresor gene. The protein encoded by this gene belongs to the EGR family of C2H2-type zinc-finger proteins. It is a nuclear protein and functions as a transcriptional regulator. The products of target genes it activates are required for differentitation and mitogenesis. Studies suggest this is a cancer suppresor gene. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express EGR1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express EGR1.
The immunogen is a synthetic peptide directed towards the N terminal region of human EGR1
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 87%; Horse: 93%; Human: 100%; Mouse: 86%; Pig: 100%; Rabbit: 86%; Rat: 93%
Complete computational species homology data:
Anti-EGR1 (ARP32241_P050)
Peptide Sequence:
Synthetic peptide located within the following region: DNYPKLEEMMLLSNGAPQFLGAAGAPEGSGSNSSSSSSGGGGGGGGGSNS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-EGR1 (ARP32241_P050) antibody is Catalog # AAP32241 (Previous Catalog # AAPP03222)
Printable datasheet for anti-EGR1 (ARP32241_P050) antibody
Additional Information:
IHC Information: Human Colon, Myenteric Plexus: Formalin-Fixed, Paraffin-Embedded (FFPE)
Target Reference:
Yu,J., et al., (2004) Mol.Cell 15(1),83-94

Barbolina, M. V, Adley, B. P., Ariztia, E. V, Liu, Y. & Stack, M. S. Microenvironmental regulation of membrane type 1 matrix metalloproteinase activity in ovarian carcinoma cells via collagen-induced EGR1 expression. J. Biol. Chem. 282, 4924-31 (2007). IHC, WB, Cow, Horse, Human, Mouse, Pig, Rabbit, Rat 17158885

Wenzel, K. et al. Expression of the protein phosphatase 1 inhibitor KEPI is downregulated in breast cancer cell lines and tissues and involved in the regulation of the tumor suppressor EGR1 via the MEK-ERK pathway. Biol. Chem. 388, 489-95 (2007). IHC, WB, Cow, Horse, Human, Mouse, Pig, Rabbit, Rat 17516844

Jaluria, P., Konstantopoulos, K., Betenbaugh, M. & Shiloach, J. Egr1 and Gas6 facilitate the adaptation of HEK-293 cells to serum-free media by conferring enhanced viability and higher growth rates. Biotechnol. Bioeng. 99, 1443-52 (2008). IHC, WB, Cow, Horse, Human, Mouse, Pig, Rabbit, Rat 18023050

Tennis, M. A. et al. Prostacyclin inhibits non-small cell lung cancer growth by a frizzled 9-dependent pathway that is blocked by secreted frizzled-related protein 1. Neoplasia 12, 244-53 (2010). IHC, WB, Cow, Horse, Human, Mouse, Pig, Rabbit, Rat 20368707

Lane, K. R. et al. Cell cycle-regulated protein abundance changes in synchronously proliferating HeLa cells include regulation of pre-mRNA splicing proteins. PLoS One 8, e58456 (2013). IHC, WB, Cow, Horse, Human, Mouse, Pig, Rabbit, Rat 23520512

Ohata, Y. et al. Elevated fibroblast growth factor 23 exerts its effects on placenta and regulates vitamin D metabolism in pregnancy of Hyp mice. J. Bone Miner. Res. 29, 1627-38 (2014). IHC, WB, Cow, Horse, Human, Mouse, Pig, Rabbit, Rat 24470103

Balakrishnan, A; Stykel, MG; Touahri, Y; Stratton, JA; Biernaskie, J; Schuurmans, C; Temporal Analysis of Gene Expression in the Murine Schwann Cell Lineage and the Acutely Injured Postnatal Nerve. 11, e0153256 (2016). IHC, WB, Cow, Horse, Human, Mouse, Pig, Rabbit, Rat 27058953

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...