Search Antibody, Protein, and ELISA Kit Solutions

EGLN2 antibody - N-terminal region (ARP34747_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP34747_P050-FITC Conjugated

ARP34747_P050-HRP Conjugated

ARP34747_P050-Biotin Conjugated

Gene Symbol:
EGLN2
NCBI Gene Id:
112398
Official Gene Full Name:
Egl nine homolog 2 (C. elegans)
Protein Name:
Egl nine homolog 2
Swissprot Id:
Q96KS0
Protein Accession #:
EAW57007
Nucleotide Accession #:
NM_053046
Alias Symbols:
EIT6, PHD1, HPH-1, HPH-3, HIFPH1, HIF-PH1
Replacement Item:
This antibody may replace item sc-45616 from Santa Cruz Biotechnology.
Description of Target:
The hypoxia inducible factor (HIF) is a transcriptional complex which is involved in oxygen homeostasis. At normal oxygen levels, the alpha subunit of HIF is targeted for degration by prolyl hydroxylation. EGLN2 encodes an enzyme responsible for this posttranslational modification. Alternative splicing of EGLN2 results in three transcript variants encoding different isoforms.
Protein Size (# AA):
146
Molecular Weight:
16kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express EGLN2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express EGLN2.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human EGLN2
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 86%; Zebrafish: 93%
Complete computational species homology data:
Anti-EGLN2 (ARP34747_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MCLPSPSKPTSLHPCQAMVACYPGNGLGYVRHVDNPHGDGRCITCIYYLN
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
SRPK2; CEP192; IKBKG; FAM46A; EPAS1; A2M; MAGEA11; SIAH2; LPP; WTIP; AJUBA; LIMD1; TRIP6; SPRY2; PRPF19; EGLN3; EGLN2; HIF1A; HIF3A; MOB4; POLR2A;
Blocking Peptide:
For anti-EGLN2 (ARP34747_P050) antibody is Catalog # AAP34747 (Previous Catalog # AAPP05941)
Datasheets/Manuals:
Printable datasheet for anti-EGLN2 (ARP34747_P050) antibody
Publications:

Gilbert, J. S., Banek, C. T., Bauer, A. J., Gingery, A. & Needham, K. Exercise training attenuates placental ischemia-induced hypertension and angiogenic imbalance in the rat. Hypertension 60, 1545-51 (2012). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish 23090773

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...