Search Antibody, Protein, and ELISA Kit Solutions

EGLN2 Antibody - N-terminal region (ARP34747_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP34747_P050-FITC Conjugated

ARP34747_P050-HRP Conjugated

ARP34747_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-45616 from Santa Cruz Biotechnology.
The immunogen is a synthetic peptide directed towards the N terminal region of human EGLN2
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 86%; Zebrafish: 93%
Complete computational species homology data:
Anti-EGLN2 (ARP34747_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MCLPSPSKPTSLHPCQAMVACYPGNGLGYVRHVDNPHGDGRCITCIYYLN
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-EGLN2 (ARP34747_P050) antibody is Catalog # AAP34747 (Previous Catalog # AAPP05941)
Printable datasheet for anti-EGLN2 (ARP34747_P050) antibody

Gilbert, J. S., Banek, C. T., Bauer, A. J., Gingery, A. & Needham, K. Exercise training attenuates placental ischemia-induced hypertension and angiogenic imbalance in the rat. Hypertension 60, 1545-51 (2012). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish 23090773

Gene Symbol:
Official Gene Full Name:
Egl nine homolog 2 (C. elegans)
Alias Symbols:
NCBI Gene Id:
Protein Name:
Egl nine homolog 2
Description of Target:
The hypoxia inducible factor (HIF) is a transcriptional complex which is involved in oxygen homeostasis. At normal oxygen levels, the alpha subunit of HIF is targeted for degration by prolyl hydroxylation. EGLN2 encodes an enzyme responsible for this posttranslational modification. Alternative splicing of EGLN2 results in three transcript variants encoding different isoforms.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Size (# AA):
Molecular Weight:
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express EGLN2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express EGLN2.
Protein Interactions:

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...