Search Antibody, Protein, and ELISA Kit Solutions

EGFR Antibody - middle region (ARP61003_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP61003_P050-FITC Conjugated

ARP61003_P050-HRP Conjugated

ARP61003_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
EGFR
Official Gene Full Name:
Epidermal growth factor receptor
NCBI Gene Id:
1956
Protein Name:
Epidermal growth factor receptor
Swissprot Id:
P00533
Protein Accession #:
NP_958439
Nucleotide Accession #:
NM_201282
Alias Symbols:
ERBB, ERBB1, HER1, PIG61, mENA
Replacement Item:
This antibody may replace item sc-03 from Santa Cruz Biotechnology.
Description of Target:
The protein encoded by this gene is a transmembrane glycoprotein that is a member of the protein kinase superfamily. This protein is a receptor for members of the epidermal growth factor family. EGFR is a cell surface protein that binds to epidermal growth factor. Binding of the protein to a ligand induces receptor dimerization and tyrosine autophosphorylation and leads to cell proliferation. Mutations in this gene are associated with lung cancer. Multiple alternatively spliced transcript variants that encode different protein isoforms have been found for this gene.
Protein Size (# AA):
628
Molecular Weight:
69kDa
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express EGFR.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express EGFR.
Predicted Homology Based on Immunogen Sequence:
Cow: 92%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 85%; Rabbit: 93%; Rat: 100%; Zebrafish: 75%
Complete computational species homology data:
Anti-EGFR (ARP61003_P050)
Peptide Sequence:
Synthetic peptide located within the following region: VTDHGSCVRACGADSYEMEEDGVRKCKKCEGPCRKVCNGIGIGEFKDSLS
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
SEC61A1; UBC; CBL; ERBB4; EMD; SEC61B; DCBLD2; PML; DERL1; SOCS5; EPHA2; UBASH3B; PTPRF; EIF2AK2; MAP2K3; MAP2K2; PRKAG1; PRKAA1; PPP2R5C; PLK1; PLCG1; PFKP; PFKM; PFKL; PFKFB3; PDK1; VAV2; UCK2; UBE2G2; DNM2; CTNND1; CSNK2A1; CSNK1A1; CSK; AP3S1; AP2S1;
Blocking Peptide:
For anti-EGFR (ARP61003_P050) antibody is Catalog # AAP61003
Datasheets/Manuals:
Printable datasheet for anti-EGFR (ARP61003_P050) antibody
Sample Type Confirmation:

EGFR is strongly supported by BioGPS gene expression data to be expressed in MDA-MB231

Product Reviews

Average Rating:
1 review
5 star
0
4 star
1
3 star
0
2 star
0
1 star
0
  • Date - Newest First
  • Date - Newest First
  • Date - Latest First
  • Highest Rated
  • Lowest Rated
  • Most Helpful
  • Ownership

1 Item(s)

02/01/2017 16:24
  • Overall Experience:
  • Quality:
Product Review: EGFR antibody-middle region (ARP61003_P050) in MDA-MB-231 cell line using Western blot
Product Page for EGFR antibody-middle region (ARP61003_P050)

Researcher: Katarzyna Augoff, University of Wroclaw
Application: Western blotting
Species + Tissue/Cell type: Lane 1: 4ug DRM fraction from MDA-MB-231
Primary antibody dilution: 1:1000
Secondary antibody: Donkey anti-rabbit IgG-HRP
Secondary antibody dilution: 1:10000


Questionnaire:
How would you rate this antibody on a scale from 1-5 (5=best) and why? 4
Please include your detailed WB Procedure/Protocol here: DRM fraction isolated from MDA-MB-231 (Protein:4 ug/well)Protocol: Related Details:
Primary antibody: ARP61003 (EGFR-antibody-middle region)
1:1000 in PBS-T-overnight/4 degree CSecondary antibody: Donkey anti-rabbit IgG-HRP sc-2313 santa cruz biotechnology, inc
1:10000 in 1% milk in PBS-T - 1h / RT
0
0
Reply
Show more comments (-2) Hide comments

1 Item(s)

What kind of abuse are you reporting?
    Please, wait...