Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP61003_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP61003_P050-FITC Conjugated

ARP61003_P050-HRP Conjugated

ARP61003_P050-Biotin Conjugated

EGFR Antibody - middle region (ARP61003_P050)

Rating:
80% of 100
Catalog#: ARP61003_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-03 from Santa Cruz Biotechnology.
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 92%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 85%; Rabbit: 93%; Rat: 100%; Zebrafish: 75%
Complete computational species homology data Anti-EGFR (ARP61003_P050)
Peptide Sequence Synthetic peptide located within the following region: VTDHGSCVRACGADSYEMEEDGVRKCKKCEGPCRKVCNGIGIGEFKDSLS
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-EGFR (ARP61003_P050) antibody is Catalog # AAP61003
Datasheets/Manuals Printable datasheet for anti-EGFR (ARP61003_P050) antibody
Sample Type Confirmation

EGFR is strongly supported by BioGPS gene expression data to be expressed in MDA-MB231

Gene Symbol EGFR
Official Gene Full Name Epidermal growth factor receptor
Alias Symbols ERBB, ERBB1, HER1, PIG61, mENA
NCBI Gene Id 1956
Protein Name Epidermal growth factor receptor
Description of Target The protein encoded by this gene is a transmembrane glycoprotein that is a member of the protein kinase superfamily. This protein is a receptor for members of the epidermal growth factor family. EGFR is a cell surface protein that binds to epidermal growth factor. Binding of the protein to a ligand induces receptor dimerization and tyrosine autophosphorylation and leads to cell proliferation. Mutations in this gene are associated with lung cancer. Multiple alternatively spliced transcript variants that encode different protein isoforms have been found for this gene.
Swissprot Id P00533
Protein Accession # NP_958439
Nucleotide Accession # NM_201282
Protein Size (# AA) 628
Molecular Weight 69kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express EGFR.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express EGFR.
Protein Interactions SEC61A1; UBC; CBL; ERBB4; EMD; SEC61B; DCBLD2; PML; DERL1; SOCS5; EPHA2; UBASH3B; PTPRF; EIF2AK2; MAP2K3; MAP2K2; PRKAG1; PRKAA1; PPP2R5C; PLK1; PLCG1; PFKP; PFKM; PFKL; PFKFB3; PDK1; VAV2; UCK2; UBE2G2; DNM2; CTNND1; CSNK2A1; CSNK1A1; CSK; AP3S1; AP2S1;
  1. What is the species homology for "EGFR Antibody - middle region (ARP61003_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish".

  2. How long will it take to receive "EGFR Antibody - middle region (ARP61003_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "EGFR Antibody - middle region (ARP61003_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "EGFR Antibody - middle region (ARP61003_P050)"?

    This target may also be called "ERBB, ERBB1, HER1, PIG61, mENA" in publications.

  5. What is the shipping cost for "EGFR Antibody - middle region (ARP61003_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "EGFR Antibody - middle region (ARP61003_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "EGFR Antibody - middle region (ARP61003_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "69kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "EGFR Antibody - middle region (ARP61003_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "EGFR"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "EGFR"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "EGFR"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "EGFR"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "EGFR"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "EGFR"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:EGFR Antibody - middle region (ARP61003_P050)
Your Rating
We found other products you might like!