EGFP Protein (OPBI00003)

Catalog No: OPBI00003

Size:0.1 mg

SDS PAGE analysis of EGFP protein. Lane 1: Protein standard markers. Lane 2: 5 ug EGFP protein, under reducing conditions. Lane 3: 5ug GFP, under non-reducing conditions.

Product Info

• Product Format: 0.2mm filtered concentrated solution in PBS, pH7.4.
• Isotype: E.coli
• Conjugation: Unconjugated
• Application: SDS-PAGE, WB
• Reconstitution and Storage: Store at -20 C for at least 1 year. After reconstitution, protein solution is stable at -20 C for 6 months to 12 months. Keep at -80 C for long term storage. Avoid repeated freeze/thaw cycles.
• Concentration: 100 ug (in 100 ul): 1 mg/ml. 200 ug (in 200 ul): 1 mg/ml
• Purity: > 95.0% as determined by RP-HPLC and analysis by SDS-PAGE
• Protein Sequence: MSYYHHHHHHDYDIPTTENLYFQGAMDPEFMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK

Target Info

• Gene Symbol: EGFP
• Alias Symbols: EGFP protein, GFP, GFP protein, EGFP, green fluorescent protein
• Description of Target: The his tagged EGFP recombinant protein is produced in E.coli and is a non-glycosylated, polypeptide chain containing 269 amino acids and having a molecular mass of approximately 30.6 kDa. The EGFP is purified by proprietary chromatographic techniques.
• Molecular Weight: 30.6 kDa