EFNA5 Antibody - middle region (ARP65431_P050)

Catalog No: ARP65431_P050

WB Suggested Anti-EFNA5 Antibody
Titration: 1.0 ug/ml
Positive Control: Hela Whole cell

Host: Mouse
Target Name: EFNA5
Sample Tissue: Mouse Pancreas
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human, Mouse
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human EFNA5
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
• Peptide Sequence: Synthetic peptide located within the following region: FDGYSACDHTSKGFKRWECNRPHSPNGPLKFSEKFQLFTPFSLGFEFRPG
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-EFNA5 (ARP65431_P050) antibody is Catalog # AAP65431

Target Info

• Gene Symbol: EFNA5
• Alias Symbols: AF1, EFL5, RAGS, EPLG7, GLC1M, LERK7
• NCBI Gene Id: 1946
• Protein Name: Ephrin-A5
• Description of Target: Ephrin-A5, a member of the ephrin gene family, prevents axon bundling in cocultures of cortical neurons with astrocytes, a model of late stage nervous system development and differentiation. The EPH and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, particularly in the nervous system. EPH receptors typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin ligands and receptors have been named by the Eph Nomenclature Committee (1997). Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. The Eph family of receptors are similarly divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands.
• Uniprot ID: P52803
• Protein Accession #: NP_001953
• Nucleotide Accession #: NM_001962
• Protein Size (# AA): 228
• Molecular Weight: 24kDa
• Protein Interactions: MYC; GRIP1; SRC; EPHA7; EPHA4; EPHB2; EPHB1; EPHA5; EPHA3; EPHA2; EPHA8;