Aviva Systems Biology office will be closed for Memorial Day - May 27, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

EFNA3 Antibody - N-terminal region : FITC (ARP76111_P050-FITC)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP76111_P050 Unconjugated

ARP76111_P050-HRP Conjugated

ARP76111_P050-Biotin Conjugated

Gene Symbol:
EFNA3
NCBI Gene Id:
1944
Swissprot Id:
P52797
Protein Accession #:
NP_004943
Alias Symbols:
EFNA3, EFL2, EPLG3, LERK3,
Replacement Item:
This antibody may replace item sc-1012 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes a member of the ephrin (EPH) family. The ephrins and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, especially in the nervous system and in erythropoiesis. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. This gene encodes an EFNA class ephrin.
Protein Size (# AA):
238
Molecular Weight:
26kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express EFNA3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express EFNA3.
Immunogen:
The immunogen is a synthetic peptide directed towards the N-terminal region of Human EFNA3
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: LLVPVPLLPLLAQGPGGALGNRHAVYWNSSNQHLRREGYTVQVNVNDYLD
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Blocking Peptide:
For anti-EFNA3 (ARP76111_P050-FITC) antibody is Catalog # AAP76111
Datasheets/Manuals:
Printable datasheet for anti-EFNA3 (ARP76111_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm
Target Reference:
N/A

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...