EFHD2 Antibody - N-terminal region (ARP58617_P050)

Catalog No: ARP58617_P050

WB Suggested Anti-EFHD2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Lung

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Pig, Yeast, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human EFHD2
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Human: 100%; Mouse: 93%; Pig: 93%; Rat: 93%; Yeast: 83%; Zebrafish: 77%
• Peptide Sequence: Synthetic peptide located within the following region: MGTPGEGLGRCSHALIRGVPESLASGEGAGAGLPALDLAKAQREHGVLGG
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-EFHD2 (ARP58617_P050) antibody is Catalog # AAP58617 (Previous Catalog # AAPP35754)
• Reference: Olsen,J.V., (2006) Cell 127 (3), 635-648

Target Info

• Gene Symbol: EFHD2
• Gene Full Name: EF-hand domain family, member D2
• Alias Symbols: SWS1
• NCBI Gene Id: 79180
• Protein Name: EF-hand domain-containing protein D2
• Description of Target: EFHD2 may regulate B-cell receptor (BCR)-induced immature and primary B-cell apoptosis. It plays a role as negative regulator of the canonical NF-kappa-B-activating branch. EFHD2 controls spontaneous apoptosis through the regulation of BCL2L1 abundance.
• Uniprot ID: Q96C19
• Protein Accession #: NP_077305
• Nucleotide Accession #: NM_024329
• Protein Size (# AA): 240
• Molecular Weight: 26kDa
• Protein Interactions: UBC; COASY; CHMP4A; GLRX3; GMPS; TSTA3; RCN1; PTPN11; IDH1; ENO2; DCK; FBXO6; PAN2; APP; LRRK2; ELAVL1;