Aviva Systems Biology office will be closed for Memorial Day - May 27, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

EFEMP1 Antibody - middle region (ARP41342_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP41342_P050-FITC Conjugated

ARP41342_P050-HRP Conjugated

ARP41342_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
EGF containing fibulin-like extracellular matrix protein 1
NCBI Gene Id:
Protein Name:
EGF-containing fibulin-like extracellular matrix protein 1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
DHRD, DRAD, FBLN3, FBNL, FLJ35535, MGC111353, MLVT, MTLV, S1-5
Replacement Item:
This antibody may replace item sc-33722 from Santa Cruz Biotechnology.
Description of Target:
EFEMP1 gene spans approximately 18 kb of genomic DNA and consists of 12 exons. Alternative splice patterns in the 5' UTR result in three transcript variants encoding the same extracellular matrix protein. Mutations in this gene are associated with Doyne honeycomb retinal dystrophy.This gene spans approximately 18 kb of genomic DNA and consists of 12 exons. Alternative splice patterns in the 5' UTR result in three transcript variants encoding the same extracellular matrix protein. Mutations in this gene are associated with Doyne honeycomb retinal dystrophy.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express EFEMP1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express EFEMP1.
The immunogen is a synthetic peptide directed towards the middle region of human EFEMP1
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Complete computational species homology data:
Anti-EFEMP1 (ARP41342_P050)
Peptide Sequence:
Synthetic peptide located within the following region: KYMSIRSDRSVPSDIFQIQATTIYANTINTFRIKSGNENGEFYLRQTSPV
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-EFEMP1 (ARP41342_P050) antibody is Catalog # AAP41342 (Previous Catalog # AAPP22613)
Printable datasheet for anti-EFEMP1 (ARP41342_P050) antibody
Target Reference:
Weedon,M.N., (2008) Nat. Genet. 40 (5), 575-583

Lutter, S., Xie, S., Tatin, F. & Makinen, T. Smooth muscle-endothelial cell communication activates Reelin signaling and regulates lymphatic vessel formation. J. Cell Biol. 197, 837-49 (2012). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 22665518

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...