Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
SKU
ARP41342_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP41342_P050-FITC Conjugated

ARP41342_P050-HRP Conjugated

ARP41342_P050-Biotin Conjugated

EFEMP1 Antibody - middle region (ARP41342_P050)

Catalog#: ARP41342_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-33722 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human EFEMP1
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Complete computational species homology data Anti-EFEMP1 (ARP41342_P050)
Peptide Sequence Synthetic peptide located within the following region: KYMSIRSDRSVPSDIFQIQATTIYANTINTFRIKSGNENGEFYLRQTSPV
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-EFEMP1 (ARP41342_P050) antibody is Catalog # AAP41342 (Previous Catalog # AAPP22613)
Datasheets/Manuals Printable datasheet for anti-EFEMP1 (ARP41342_P050) antibody
Target Reference Weedon,M.N., (2008) Nat. Genet. 40 (5), 575-583
Publications

Lutter, S., Xie, S., Tatin, F. & Makinen, T. Smooth muscle-endothelial cell communication activates Reelin signaling and regulates lymphatic vessel formation. J. Cell Biol. 197, 837-49 (2012). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 22665518

Gene Symbol EFEMP1
Official Gene Full Name EGF containing fibulin-like extracellular matrix protein 1
Alias Symbols DHRD, DRAD, FBLN3, FBNL, FLJ35535, MGC111353, MLVT, MTLV, S1-5
NCBI Gene Id 2202
Protein Name EGF-containing fibulin-like extracellular matrix protein 1
Description of Target EFEMP1 gene spans approximately 18 kb of genomic DNA and consists of 12 exons. Alternative splice patterns in the 5' UTR result in three transcript variants encoding the same extracellular matrix protein. Mutations in this gene are associated with Doyne honeycomb retinal dystrophy.This gene spans approximately 18 kb of genomic DNA and consists of 12 exons. Alternative splice patterns in the 5' UTR result in three transcript variants encoding the same extracellular matrix protein. Mutations in this gene are associated with Doyne honeycomb retinal dystrophy.
Swissprot Id Q12805
Protein Accession # NP_004096
Nucleotide Accession # NM_004105
Protein Size (# AA) 493
Molecular Weight 53kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express EFEMP1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express EFEMP1.
Protein Interactions TXNDC5; RIC8A; BAG6; TRAF2; SGTA; env; HCVgp1; KHDRBS1; TNIP1; SOCS6; UBC; PDIA3; NOS3; GFI1B; ATN1; RERE; ATXN7; CACNA1A; ARAF; TIMP3; RAF1;
Write Your Own Review
You're reviewing:EFEMP1 Antibody - middle region (ARP41342_P050)
Your Rating