SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP58457_P050
Price: $0.00
SKU
ARP58457_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-EEF2 (ARP58457_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Additional InformationIHC Information: Small intestine
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human EEF2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 100%
Peptide SequenceSynthetic peptide located within the following region: TDSLVCKAGIIASARAGETRFTDTRKDEQERCITIKSTAISLFYELSEND
Concentration0.5 mg/ml
Blocking PeptideFor anti-EEF2 (ARP58457_P050) antibody is Catalog # AAP58457 (Previous Catalog # AAPP34564)
ReferenceTu,L.C., (2007) Mol. Cell Proteomics 6 (4), 575-588
Publications

Chaperone Function of Hgh1 in the Biogenesis of Eukaryotic Elongation Factor 2. Mol Cell. 74, 88-100.e9 (2019). 30876804

Description
Gene SymbolEEF2
Gene Full NameEukaryotic translation elongation factor 2
Alias SymbolsEF2, EF-2, EEF-2, SCA26
NCBI Gene Id1938
Protein NameElongation factor 2
Description of TargetEEF2 is a member of the GTP-binding translation elongation factor family. The protein is an essential factor for protein synthesis. It promotes the GTP-dependent translocation of the nascent protein chain from the A-site to the P-site of the ribosome. This protein is completely inactivated by EF-2 kinase phosporylation.This gene encodes a member of the GTP-binding translation elongation factor family. This protein is an essential factor for protein synthesis. It promotes the GTP-dependent translocation of the nascent protein chain from the A-site to the P-site of the ribosome. This protein is completely inactivated by EF-2 kinase phosporylation. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Uniprot IDP13639
Protein Accession #NP_001952
Nucleotide Accession #NM_001961
Protein Size (# AA)858
Molecular Weight94kDa
Protein InteractionsYJR129C; EEF2KMT; HUWE1; ISG15; UBC; FUS; SUMO2; SUMO3; LGR4; SUMO1; RPS6KA1; NEDD8; MDM2; RNF2; SHFM1; XPO1; EIF4H; PGD; FTO; GINS2; YWHAQ; BZW1; PFAS; PAK2; MAT2A; GSR; TYMP; CKB; CDKN2A; CASP7; CAPN1; HIPK4; CDK20; TARDBP; CDK18; HNRNPD; MAPK14; ADRB2;
  1. What is the species homology for "EEF2 Antibody - N-terminal region (ARP58457_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Zebrafish".

  2. How long will it take to receive "EEF2 Antibody - N-terminal region (ARP58457_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "EEF2 Antibody - N-terminal region (ARP58457_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "EEF2 Antibody - N-terminal region (ARP58457_P050)"?

    This target may also be called "EF2, EF-2, EEF-2, SCA26" in publications.

  5. What is the shipping cost for "EEF2 Antibody - N-terminal region (ARP58457_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "EEF2 Antibody - N-terminal region (ARP58457_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "EEF2 Antibody - N-terminal region (ARP58457_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "94kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "EEF2 Antibody - N-terminal region (ARP58457_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "EEF2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "EEF2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "EEF2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "EEF2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "EEF2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "EEF2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:EEF2 Antibody - N-terminal region (ARP58457_P050)
Your Rating
We found other products you might like!