Aviva Systems Biology office will be closed for Christmas and New Year Holiday - December 24-25, 2018 and January 1, 2019.
Please go here for more info.

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

EEA1 antibody - middle region (ARP58125_P050)

100 ul
$289.00
In Stock

Conjugation Options

ARP58125_P050-FITC Conjugated

ARP58125_P050-HRP Conjugated

ARP58125_P050-Biotin Conjugated

Gene Symbol:
EEA1
NCBI Gene Id:
8411
Official Gene Full Name:
Early endosome antigen 1
Protein Name:
Early endosome antigen 1
Swissprot Id:
Q15075
Protein Accession #:
NP_003557
Nucleotide Accession #:
NM_003566
Alias Symbols:
ZFYVE2, MST105, MSTP105
Replacement Item:
This antibody may replace item sc-137130 from Santa Cruz Biotechnology.
Description of Target:
EEA1 is involved in neuronal synaptic vesicle function and axonal transport and growth. EEA1 may undergo calcium-dependent conformational changes that are required for binding to SNAP-25.
Protein Size (# AA):
1411
Molecular Weight:
162kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express EEA1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express EEA1.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human EEA1
Species Reactivity:
Cow, Dog, Horse, Human, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 79%; Dog: 79%; Horse: 79%; Human: 100%; Rabbit: 79%; Rat: 90%
Complete computational species homology data:
Anti-EEA1 (ARP58125_P050)
Peptide Sequence:
Synthetic peptide located within the following region: QEKRNQQILKDQVKKEEEELKKEFIEKEAKLHSEIKEKEVGMKKHEENEA
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; RNF2; BMI1; CFTR; ERBB2; VCP; EEA1; RAB5A; TNK2; RABEP1; RABGEF1; PDCD6IP; PXK; HDAC6; ZFYVE16; USO1; STX6; RAB22A; STX12; TOM1; RAB5C; MAPK14; RAB5B; IGF1R; NSF;
Blocking Peptide:
For anti-EEA1 (ARP58125_P050) antibody is Catalog # AAP58125 (Previous Catalog # AAPP32558)
Datasheets/Manuals:
Printable datasheet for anti-EEA1 (ARP58125_P050) antibody
Sample Type Confirmation:

EEA1 is supported by BioGPS gene expression data to be expressed in 721_B

Target Reference:
Selak,S., (2006) Neuroscience 143 (4), 953-964

Tell us what you think about this item!

Write A Review
    Please, wait...