Loading...
Catalog No: ARP58125_P050
Price: $0.00
SKU
ARP58125_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-EEA1 (ARP58125_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Rat, Cow, Dog, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human EEA1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 79%; Dog: 79%; Horse: 79%; Human: 100%; Rabbit: 79%; Rat: 90%
Peptide SequenceSynthetic peptide located within the following region: QEKRNQQILKDQVKKEEEELKKEFIEKEAKLHSEIKEKEVGMKKHEENEA
Concentration0.5 mg/ml
Blocking PeptideFor anti-EEA1 (ARP58125_P050) antibody is Catalog # AAP58125 (Previous Catalog # AAPP32558)
Sample Type Confirmation

EEA1 is supported by BioGPS gene expression data to be expressed in 721_B

ReferenceSelak,S., (2006) Neuroscience 143 (4), 953-964
Gene SymbolEEA1
Gene Full NameEarly endosome antigen 1
Alias SymbolsMST105, ZFYVE2, MSTP105
NCBI Gene Id8411
Protein NameEarly endosome antigen 1
Description of TargetEEA1 is involved in neuronal synaptic vesicle function and axonal transport and growth. EEA1 may undergo calcium-dependent conformational changes that are required for binding to SNAP-25.
Uniprot IDQ15075
Protein Accession #NP_003557
Nucleotide Accession #NM_003566
Protein Size (# AA)1411
Molecular Weight162kDa
Protein InteractionsUBC; RNF2; BMI1; CFTR; ERBB2; VCP; EEA1; RAB5A; TNK2; RABEP1; RABGEF1; PDCD6IP; PXK; HDAC6; ZFYVE16; USO1; STX6; RAB22A; STX12; TOM1; RAB5C; MAPK14; RAB5B; IGF1R; NSF;
  1. What is the species homology for "EEA1 Antibody - middle region (ARP58125_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Rat, Cow, Dog, Horse, Rabbit".

  2. How long will it take to receive "EEA1 Antibody - middle region (ARP58125_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "EEA1 Antibody - middle region (ARP58125_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "EEA1 Antibody - middle region (ARP58125_P050)"?

    This target may also be called "MST105, ZFYVE2, MSTP105" in publications.

  5. What is the shipping cost for "EEA1 Antibody - middle region (ARP58125_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "EEA1 Antibody - middle region (ARP58125_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "EEA1 Antibody - middle region (ARP58125_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "162kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "EEA1 Antibody - middle region (ARP58125_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "EEA1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "EEA1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "EEA1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "EEA1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "EEA1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "EEA1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:EEA1 Antibody - middle region (ARP58125_P050)
Your Rating
We found other products you might like!