EDNRA Antibody - C-terminal region (ARP64011_P050)

Catalog No: ARP64011_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

WB Suggested Anti-EDNRA Antibody
Titration: 1.0 ug/ml
Positive Control: Jurkat Whole Cell

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 86%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 79%; Rabbit: 93%; Sheep: 79%
• Peptide Sequence: Synthetic peptide located within the following region: KNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRSSHKDSM
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-EDNRA (ARP64011_P050) antibody is Catalog # AAP64011

Target Info

• Gene Symbol: EDNRA
• Gene Full Name: Endothelin receptor type A
• Alias Symbols: ETA, ET-A, ETAR, ETRA, MFDA, ETA-R, hET-AR
• NCBI Gene Id: 1909
• Protein Name: Endothelin-1 receptor
• Description of Target: This gene encodes the receptor for endothelin-1, a peptide that plays a role in potent and long-lasting vasoconstriction. This receptor associates with guanine-nucleotide-binding (G) proteins, and this coupling activates a phosphatidylinositol-calcium second messenger system. Polymorphisms in this gene have been linked to migraine headache resistance.
• Uniprot ID: P25101
• Protein Accession #: NP_001159527
• Nucleotide Accession #: NM_001166055
• Protein Size (# AA): 318
• Molecular Weight: 34kDa
• Protein Interactions: VPS11; EDN1; SRC; ARRB2; ARRB1; COPS5; UBC; KAT5; GRK6; GNAI2; GNA11; EDN3; HDAC7;