Search Antibody, Protein, and ELISA Kit Solutions

EDN3 Antibody - middle region (ARP84569_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Human
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
EDN3
Official Gene Full Name:
endothelin 3
NCBI Gene Id:
1908
Protein Name:
endothelin-3
Swissprot Id:
P14138-3
Protein Accession #:
NP_001289384.1
Nucleotide Accession #:
NM_001302455.1
Alias Symbols:
ET3, ET-3, WS4B, HSCR4, PPET3
Description of Target:
The protein encoded by this gene is a member of the endothelin family. Endothelins are endothelium-derived vasoactive peptides involved in a variety of biological functions. The active form of this protein is a 21 amino acid peptide processed from the precursor protein. The active peptide is a ligand for endothelin receptor type B (EDNRB). The interaction of this endothelin with EDNRB is essential for development of neural crest-derived cell lineages, such as melanocytes and enteric neurons. Mutations in this gene and EDNRB have been associated with Hirschsprung disease (HSCR) and Waardenburg syndrome (WS), which are congenital disorders involving neural crest-derived cells. Altered expression of this gene is implicated in tumorigenesis. Alternative splicing results in multiple transcript variants encoding different isoforms.
Protein Size (# AA):
219
Molecular Weight:
24 kDa
Purification:
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express EDN3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express EDN3.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human EDN3
Peptide Sequence:
Synthetic peptide located within the following region: TQTLDVSSNSRTAEKTDKEEEGKVEVKDQQSKQALDLHHPKLMPGSGLAL
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-EDN3 (ARP84569_P050) antibody is Catalog # AAP84569
Datasheets/Manuals:
Printable datasheet for anti-EDN3 (ARP84569_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...