EDG8 Antibody - N-terminal region (ARP42661_T100)

Catalog No: ARP42661_T100

WB Suggested Anti-EDG8 Antibody Titration: 2.5ug/ml
Positive Control: Jurkat cell lysate

Human Intestine

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Pig
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human EDG8
• Purification: Protein A purified
• Predicted Homology Based on Immunogen Sequence: Cow: 80%; Dog: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: MESGLLRPAPVSEVIVLHYNYTGKLRGARYQPGAGLRADAVVCLAVCAFI
• Concentration: 1.0 mg/ml
• Blocking Peptide: For anti-S1PR5 (ARP42661_T100) antibody is Catalog # AAP43008 (Previous Catalog # AAPP11218)
• Reference: Guinn,B.A., (2005) Biochem. Biophys. Res. Commun. 335 (4), 1293-1304
• Publications:

  Sphingosine 1-phospate differentially modulates maturation and function of human Langerhans-like cells. J. Dermatol. Sci. 82, 9-17 (2016). 26803226

Target Info

• Gene Symbol: S1PR5
• Gene Full Name: Sphingosine-1-phosphate receptor 5
• Alias Symbols: EDG8, S1P5, Edg-8, SPPR-1, SPPR-2
• NCBI Gene Id: 53637
• Protein Name: Sphingosine 1-phosphate receptor 5
• Description of Target: EDG8 is a receptor for the lysosphingolipid sphingosine 1-phosphate (S1P). S1P is a bioactive lysophospholipid that elicits diverse physiological effect on most types of cells and tissues. It Is coupled to both the G(i/0)alpha and G(12) subclass of heteromeric G-proteins (By similarity). It may play a regulatory role in the transformation of radial glial cells into astrocytes and may affect proliferative activity of these cells.The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme functions in the ubiquitination of the tumor-suppressor protein p53, which is induced by an E3 ubiquitin-protein ligase. Two alternatively spliced transcript variants have been found for this gene and they encode distinct isoforms.
• Uniprot ID: Q9H228
• Protein Accession #: EAW84115
• Nucleotide Accession #: NM_003339
• Protein Size (# AA): 147
• Molecular Weight: 16kDa
• Protein Interactions: TP63; GNA12; GNAO1; GNAI1; SGPP1;