Size:100 ul
$289.00
In Stock
SKU
ARP35695_P050-Biotin
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP35695_P050 Unconjugated

ARP35695_P050-FITC Conjugated

ARP35695_P050-HRP Conjugated

EDF1 Antibody - N-terminal region : Biotin (ARP35695_P050-Biotin)

Catalog#: ARP35695_P050-Biotin
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Clonality Polyclonal
Host Rabbit
Conjugation Biotin
Application IF, WB
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Replacement Item This antibody may replace item sc-133536 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human EDF1
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 79%
Complete computational species homology data Anti-EDF1 (ARP35695_P050)
Peptide Sequence Synthetic peptide located within the following region: MAESDWDTVTVLRKKGPTAAQAKSKQAILAAQRRGEDVETSKKWAAGQNK
Concentration 0.5 mg/ml
Blocking Peptide For anti-EDF1 (ARP35695_P050-Biotin) antibody is Catalog # AAP35695 (Previous Catalog # AAPP23549)
Datasheets/Manuals Printable datasheet for anti-EDF1 (ARP35695_P050-Biotin) antibody
Target Reference Bolognese,F., Gene 374, 87-95 (2006)
Publications

Leidi, M., Mariotti, M. & Maier, J. A. M. Transcriptional coactivator EDF-1 is required for PPARgamma-stimulated adipogenesis. Cell. Mol. Life Sci. 66, 2733-42 (2009). WB, Pig, Rat, Dog, Horse, Guinea pig, Human, Bovine, Mouse, Zebrafish 19554257

Leidi, M., Mariotti, M. & Maier, J. A. M. The effects of silencing EDF-1 in human endothelial cells. Atherosclerosis 211, 55-60 (2010). WB, Pig, Rat, Dog, Horse, Guinea pig, Human, Bovine, Mouse, Zebrafish 20185128

Leidi, M., Mariotti, M. & Maier, J. A. M. EDF-1 contributes to the regulation of nitric oxide release in VEGF-treated human endothelial cells. Eur. J. Cell Biol. 89, 654-60 (2010). WB, Pig, Rat, Dog, Horse, Guinea pig, Human, Bovine, Mouse, Zebrafish 20605058

Gene Symbol EDF1
Official Gene Full Name Endothelial differentiation-related factor 1
Alias Symbols EDF-1, MBF1, MGC9058
NCBI Gene Id 8721
Protein Name Endothelial differentiation-related factor 1
Description of Target EDF1 encodes a protein that may regulate endothelial cell differentiation. It has been postulated that the protein functions as a bridging molecule that interconnects regulatory proteins and the basal transcriptional machinery, thereby modulating the tran
Swissprot Id O60869
Protein Accession # NP_003783
Nucleotide Accession # NM_003792
Protein Size (# AA) 148
Molecular Weight 16kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express EDF1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express EDF1.
Protein Interactions MEOX2; UBC; IDH3G; UBE2I; MAPK6; NRL; JUN; CEBPA; NR1H3; NR5A2; PPARG; TBP; TAF1; NR5A1; RXRA; PRKCA; ATF2; CREB1; ATF1; CALM3; CALM1;
  1. What is the species homology for "EDF1 Antibody - N-terminal region : Biotin (ARP35695_P050-Biotin)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish".

  2. How long will it take to receive "EDF1 Antibody - N-terminal region : Biotin (ARP35695_P050-Biotin)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "EDF1 Antibody - N-terminal region : Biotin (ARP35695_P050-Biotin)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "EDF1 Antibody - N-terminal region : Biotin (ARP35695_P050-Biotin)"?

    This target may also be called "EDF-1, MBF1, MGC9058" in publications.

  5. What is the shipping cost for "EDF1 Antibody - N-terminal region : Biotin (ARP35695_P050-Biotin)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "EDF1 Antibody - N-terminal region : Biotin (ARP35695_P050-Biotin)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "EDF1 Antibody - N-terminal region : Biotin (ARP35695_P050-Biotin)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "16kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "EDF1 Antibody - N-terminal region : Biotin (ARP35695_P050-Biotin)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "EDF1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "EDF1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "EDF1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "EDF1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "EDF1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "EDF1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:EDF1 Antibody - N-terminal region : Biotin (ARP35695_P050-Biotin)
Your Rating
We found other products you might like!