EDF1 Antibody - N-terminal region (ARP35695_P050)

Catalog No: ARP35695_P050

WB Suggested Anti-EDF1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: THP-1 cell lysate

WB Suggested Anti-GPD1 Antibody
Titration: 5 ug/ml
Positive Control: HG

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IF, WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human EDF1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 79%
• Peptide Sequence: Synthetic peptide located within the following region: MAESDWDTVTVLRKKGPTAAQAKSKQAILAAQRRGEDVETSKKWAAGQNK
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-EDF1 (ARP35695_P050) antibody is Catalog # AAP35695 (Previous Catalog # AAPP23549)
• Reference: Bolognese,F., Gene 374, 87-95 (2006)
• Publications:

  Leidi, M., Mariotti, M. & Maier, J. A. M. EDF-1 contributes to the regulation of nitric oxide release in VEGF-treated human endothelial cells. Eur. J. Cell Biol. 89, 654-60 (2010). 20605058

  Leidi, M., Mariotti, M. & Maier, J. A. M. The effects of silencing EDF-1 in human endothelial cells. Atherosclerosis 211, 55-60 (2010). 20185128

  Leidi, M., Mariotti, M. & Maier, J. A. M. Transcriptional coactivator EDF-1 is required for PPARgamma-stimulated adipogenesis. Cell. Mol. Life Sci. 66, 2733-42 (2009). 19554257

Target Info

• Gene Symbol: EDF1
• Gene Full Name: Endothelial differentiation-related factor 1
• Alias Symbols: MBF1, EDF-1, CFAP280
• NCBI Gene Id: 8721
• Protein Name: Endothelial differentiation-related factor 1
• Description of Target: EDF1 encodes a protein that may regulate endothelial cell differentiation. It has been postulated that the protein functions as a bridging molecule that interconnects regulatory proteins and the basal transcriptional machinery, thereby modulating the tran
• Uniprot ID: O60869
• Protein Accession #: NP_003783
• Nucleotide Accession #: NM_003792
• Protein Size (# AA): 148
• Molecular Weight: 16kDa
• Protein Interactions: MEOX2; UBC; IDH3G; UBE2I; MAPK6; NRL; JUN; CEBPA; NR1H3; NR5A2; PPARG; TBP; TAF1; NR5A1; RXRA; PRKCA; ATF2; CREB1; ATF1; CALM3; CALM1;