Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
SKU
ARP35695_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP35695_P050-FITC Conjugated

ARP35695_P050-HRP Conjugated

ARP35695_P050-Biotin Conjugated

EDF1 Antibody - N-terminal region (ARP35695_P050)

Catalog#: ARP35695_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIF, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-133536 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human EDF1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 79%
Complete computational species homology dataAnti-EDF1 (ARP35695_P050)
Peptide SequenceSynthetic peptide located within the following region: MAESDWDTVTVLRKKGPTAAQAKSKQAILAAQRRGEDVETSKKWAAGQNK
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-EDF1 (ARP35695_P050) antibody is Catalog # AAP35695 (Previous Catalog # AAPP23549)
Datasheets/ManualsPrintable datasheet for anti-EDF1 (ARP35695_P050) antibody
Target ReferenceBolognese,F., Gene 374, 87-95 (2006)
Publications

Leidi, M., Mariotti, M. & Maier, J. A. M. EDF-1 contributes to the regulation of nitric oxide release in VEGF-treated human endothelial cells. Eur. J. Cell Biol. 89, 654-60 (2010). IF, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish 20605058

Leidi, M., Mariotti, M. & Maier, J. A. M. The effects of silencing EDF-1 in human endothelial cells. Atherosclerosis 211, 55-60 (2010). IF, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish 20185128

Leidi, M., Mariotti, M. & Maier, J. A. M. Transcriptional coactivator EDF-1 is required for PPARgamma-stimulated adipogenesis. Cell. Mol. Life Sci. 66, 2733-42 (2009). IF, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish 19554257

Gene SymbolEDF1
Official Gene Full NameEndothelial differentiation-related factor 1
Alias SymbolsEDF-1, MBF1, MGC9058
NCBI Gene Id8721
Protein NameEndothelial differentiation-related factor 1
Description of TargetEDF1 encodes a protein that may regulate endothelial cell differentiation. It has been postulated that the protein functions as a bridging molecule that interconnects regulatory proteins and the basal transcriptional machinery, thereby modulating the tran
Swissprot IdO60869
Protein Accession #NP_003783
Nucleotide Accession #NM_003792
Protein Size (# AA)148
Molecular Weight16kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express EDF1.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express EDF1.
Protein InteractionsMEOX2; UBC; IDH3G; UBE2I; MAPK6; NRL; JUN; CEBPA; NR1H3; NR5A2; PPARG; TBP; TAF1; NR5A1; RXRA; PRKCA; ATF2; CREB1; ATF1; CALM3; CALM1;
Write Your Own Review
You're reviewing:EDF1 Antibody - N-terminal region (ARP35695_P050)
Your Rating
Aviva ChIP Antibodies
Aviva Blast Tool
Aviva Pathways
Assay Development