Aviva Systems Biology office will be closed for Good Friday - April 19, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

EDF1 Antibody - N-terminal region (ARP35695_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP35695_P050-FITC Conjugated

ARP35695_P050-HRP Conjugated

ARP35695_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Endothelial differentiation-related factor 1
NCBI Gene Id:
Protein Name:
Endothelial differentiation-related factor 1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
EDF-1, MBF1, MGC9058
Replacement Item:
This antibody may replace item sc-133536 from Santa Cruz Biotechnology.
Description of Target:
EDF1 encodes a protein that may regulate endothelial cell differentiation. It has been postulated that the protein functions as a bridging molecule that interconnects regulatory proteins and the basal transcriptional machinery, thereby modulating the tran
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express EDF1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express EDF1.
The immunogen is a synthetic peptide directed towards the N terminal region of human EDF1
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 79%
Complete computational species homology data:
Anti-EDF1 (ARP35695_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MAESDWDTVTVLRKKGPTAAQAKSKQAILAAQRRGEDVETSKKWAAGQNK
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-EDF1 (ARP35695_P050) antibody is Catalog # AAP35695 (Previous Catalog # AAPP23549)
Printable datasheet for anti-EDF1 (ARP35695_P050) antibody
Target Reference:
Bolognese,F., Gene 374, 87-95 (2006)

Leidi, M., Mariotti, M. & Maier, J. A. M. EDF-1 contributes to the regulation of nitric oxide release in VEGF-treated human endothelial cells. Eur. J. Cell Biol. 89, 654-60 (2010). IF, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish 20605058

Leidi, M., Mariotti, M. & Maier, J. A. M. The effects of silencing EDF-1 in human endothelial cells. Atherosclerosis 211, 55-60 (2010). IF, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish 20185128

Leidi, M., Mariotti, M. & Maier, J. A. M. Transcriptional coactivator EDF-1 is required for PPARgamma-stimulated adipogenesis. Cell. Mol. Life Sci. 66, 2733-42 (2009). IF, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish 19554257

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...