ECHDC1 Antibody - middle region (ARP48841_P050)

Catalog No: ARP48841_P050

WB Suggested Anti-ECHDC1 Antibody Titration: 0.2-1 ug/ml
Positive Control: MCF7 cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ECHDC1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 92%; Rabbit: 93%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: GVMMLQLLEKVIELENWTEGKGLIVRGAKNTFSSGSDLNAVKSLGTPEDG
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-ECHDC1 (ARP48841_P050) antibody is Catalog # AAP48841 (Previous Catalog # AAPP28891)
• Reference: Gold,B., (2008) Proc. Natl. Acad. Sci. U.S.A. 105 (11), 4340-4345

Target Info

• Gene Symbol: ECHDC1
• Gene Full Name: Enoyl CoA hydratase domain containing 1
• Alias Symbols: MMCD, HEL-S-76, dJ351K20.2
• NCBI Gene Id: 55862
• Protein Name: Ethylmalonyl-CoA decarboxylase
• Description of Target: ECHDC1 belongs to the enoyl-CoA hydratase/isomerase family. The exact function of ECHDC1 remains unknown.
• Uniprot ID: Q9NTX5
• Protein Accession #: NP_001002030
• Nucleotide Accession #: NM_001002030
• Protein Size (# AA): 301
• Molecular Weight: 33kDa
• Protein Interactions: UBC; VKORC1; APP;