EBP Antibody - N-terminal region (ARP46742_P050)

Catalog No: ARP46742_P050

WB Suggested Anti-EBP Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysateEBP is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human EBP
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 93%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 85%; Pig: 93%; Rabbit: 93%; Rat: 85%
• Peptide Sequence: Synthetic peptide located within the following region: LVIEGWFVLYYEDLLGDQAFLSQLWKEYAKGDSRYILGDNFTVCMETITA
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-EBP (ARP46742_P050) antibody is Catalog # AAP46742 (Previous Catalog # AAPP27543)
• Sample Type Confirmation:

  EBP is strongly supported by BioGPS gene expression data to be expressed in Jurkat

• Reference: Berthois,Y., (2003) Br. J. Cancer 88 (3), 438-446
• Description:
  View product citations for EBP Antibody - N-terminal region (ARP46742_P050) on CiteAb

Target Info

• Gene Symbol: EBP
• Gene Full Name: Emopamil binding protein (sterol isomerase)
• Alias Symbols: CPX, CHO2, CPXD, MEND, CDPX2
• NCBI Gene Id: 10682
• Protein Name: 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase
• Description of Target: EBP is an integral membrane protein of the endoplasmic reticulum. It is a high affinity binding protein for the antiischemic phenylalkylamine Ca2+ antagonist [3H]emopamil and the photoaffinity label [3H]azidopamil. It is similar to sigma receptors and may be a member of a superfamily of high affinity drug-binding proteins in the endoplasmic reticulum of different tissues. These aromatic amino acid residues have been suggested to be involved in the drug transport by the P-glycoprotein. Mutations in EBP gene cause Chondrodysplasia punctata 2 (CDPX2; also known as Conradi-Hunermann syndrome).Emopamil-binding protein (EBP) is an integral membrane protein of the endoplasmic reticulum. It is a high affinity binding protein for the antiischemic phenylalkylamine Ca2+ antagonist [3H]emopamil and the photoaffinity label [3H]azidopamil. It is similar to sigma receptors and may be a member of a superfamily of high affinity drug-binding proteins in the endoplasmic reticulum of different tissues. EBP shares structural features with bacterial and eukaryontic drug transporting proteins. It has four putative transmembrane segments and contains two conserved glutamate residues which may be involved in the transport of cationic amphiphilics. Another prominent feature of EBP is its high content of aromatic amino acid residues (>23%) in its transmembrane segments. These aromatic amino acid residues have been suggested to be involved in the drug transport by the P-glycoprotein. Mutations in this gene cause Chondrodysplasia punctata 2 (CDPX2; also known as Conradi-Hunermann syndrome).
• Uniprot ID: Q15125
• Protein Accession #: NP_006570
• Nucleotide Accession #: NM_006579
• Protein Size (# AA): 230
• Molecular Weight: 26kDa
• Protein Interactions: UBC; MITF; VKORC1; APP; ELAVL1; ESRRG; EBPL;