SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP31837_T100
Price: $0.00
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-EBF3 (ARP31837_T100) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human EBF3
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Peptide SequenceSynthetic peptide located within the following region: AHTGMMGVNSFSSQLAVNVSETSQANDQVGYSRNTSSVSPRGYVPSSTPQ
Concentration1.0 mg/ml
Blocking PeptideFor anti-EBF3 (ARP31837_T100) antibody is Catalog # AAP31837 (Previous Catalog # AAPP02632)
ReferenceOta,T., et al., (2004) Nat. Genet. 36 (1), 40-45

Bennett, K. L., Romigh, T. & Eng, C. Disruption of transforming growth factor-beta signaling by five frequently methylated genes leads to head and neck squamous cell carcinoma pathogenesis. Cancer Res. 69, 9301-5 (2009). 19934318

Gene SymbolEBF3
Gene Full NameEarly B-cell factor 3
Alias SymbolsCOE3, OE-2, EBF-3, HADDS, O/E-2
NCBI Gene Id253738
Protein NameTranscription factor COE3
Description of TargetEB1 family proteins are evolutionarily conserved proteins that bind microtubule plus-ends and centrosomes and regulate the dynamics and organization of microtubules. Human EB1 family proteins, which include EB1, EBF3, and RP1, also associate with the tumor suppressor protein adenomatous polyposis coli (APC) and p150glued, a component of the dynactin complex.
Uniprot IDQ9H4W6
Protein Accession #NP_001005463
Nucleotide Accession #NM_001005463
Protein Size (# AA)551
Molecular Weight60kDa
Protein InteractionsZNF423;
  1. What is the species homology for "EBF3 Antibody - middle region (ARP31837_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit, Zebrafish".

  2. How long will it take to receive "EBF3 Antibody - middle region (ARP31837_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "EBF3 Antibody - middle region (ARP31837_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact

  4. What are other names for "EBF3 Antibody - middle region (ARP31837_T100)"?

    This target may also be called "COE3, OE-2, EBF-3, HADDS, O/E-2" in publications.

  5. What is the shipping cost for "EBF3 Antibody - middle region (ARP31837_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "EBF3 Antibody - middle region (ARP31837_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "EBF3 Antibody - middle region (ARP31837_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "60kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "EBF3 Antibody - middle region (ARP31837_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "EBF3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "EBF3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "EBF3"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "EBF3"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "EBF3"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "EBF3"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:EBF3 Antibody - middle region (ARP31837_T100)
Your Rating
We found other products you might like!