Size:100 ul
$229.00
In stock
SKU
ARP31837_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP31837_T100-FITC Conjugated

ARP31837_T100-HRP Conjugated

ARP31837_T100-Biotin Conjugated

EBF3 Antibody - middle region (ARP31837_T100)

Catalog#: ARP31837_T100
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-137039 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human EBF3
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data Anti-EBF3 (ARP31837_T100)
Peptide Sequence Synthetic peptide located within the following region: AHTGMMGVNSFSSQLAVNVSETSQANDQVGYSRNTSSVSPRGYVPSSTPQ
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-EBF3 (ARP31837_T100) antibody is Catalog # AAP31837 (Previous Catalog # AAPP02632)
Datasheets/Manuals Printable datasheet for anti-EBF3 (ARP31837_T100) antibody
Target Reference Ota,T., et al., (2004) Nat. Genet. 36 (1), 40-45
Publications

Bennett, K. L., Romigh, T. & Eng, C. Disruption of transforming growth factor-beta signaling by five frequently methylated genes leads to head and neck squamous cell carcinoma pathogenesis. Cancer Res. 69, 9301-5 (2009). WB, Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish 19934318

Gene Symbol EBF3
Official Gene Full Name Early B-cell factor 3
Alias Symbols COE3, OE-2, EBF-3, O/E-2
NCBI Gene Id 253738
Protein Name Transcription factor COE3
Description of Target EB1 family proteins are evolutionarily conserved proteins that bind microtubule plus-ends and centrosomes and regulate the dynamics and organization of microtubules. Human EB1 family proteins, which include EB1, EBF3, and RP1, also associate with the tumor suppressor protein adenomatous polyposis coli (APC) and p150glued, a component of the dynactin complex.
Swissprot Id Q9H4W6
Protein Accession # NP_001005463
Nucleotide Accession # NM_001005463
Protein Size (# AA) 551
Molecular Weight 60kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express EBF3.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express EBF3.
Protein Interactions ZNF423;
Write Your Own Review
You're reviewing:EBF3 Antibody - middle region (ARP31837_T100)
Your Rating