Search Antibody, Protein, and ELISA Kit Solutions

EBF3 Antibody - middle region (ARP31837_T100)

100 ul
$229.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP31837_T100-FITC Conjugated

ARP31837_T100-HRP Conjugated

ARP31837_T100-Biotin Conjugated

Gene Symbol:
EBF3
Official Gene Full Name:
Early B-cell factor 3
NCBI Gene Id:
253738
Protein Name:
Transcription factor COE3
Swissprot Id:
Q9H4W6
Protein Accession #:
NP_001005463
Nucleotide Accession #:
NM_001005463
Alias Symbols:
COE3, OE-2, EBF-3, O/E-2
Replacement Item:
This antibody may replace item sc-137039 from Santa Cruz Biotechnology.
Description of Target:
EB1 family proteins are evolutionarily conserved proteins that bind microtubule plus-ends and centrosomes and regulate the dynamics and organization of microtubules. Human EB1 family proteins, which include EB1, EBF3, and RP1, also associate with the tumor suppressor protein adenomatous polyposis coli (APC) and p150glued, a component of the dynactin complex.
Protein Size (# AA):
551
Molecular Weight:
60kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Protein A purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express EBF3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express EBF3.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human EBF3
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-EBF3 (ARP31837_T100)
Peptide Sequence:
Synthetic peptide located within the following region: AHTGMMGVNSFSSQLAVNVSETSQANDQVGYSRNTSSVSPRGYVPSSTPQ
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
ZNF423;
Blocking Peptide:
For anti-EBF3 (ARP31837_T100) antibody is Catalog # AAP31837 (Previous Catalog # AAPP02632)
Datasheets/Manuals:
Printable datasheet for anti-EBF3 (ARP31837_T100) antibody
Target Reference:
Ota,T., et al., (2004) Nat. Genet. 36 (1), 40-45
Publications:

Bennett, K. L., Romigh, T. & Eng, C. Disruption of transforming growth factor-beta signaling by five frequently methylated genes leads to head and neck squamous cell carcinoma pathogenesis. Cancer Res. 69, 9301-5 (2009). WB, Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish 19934318

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...