Search Antibody, Protein, and ELISA Kit Solutions

EBF3 Antibody - middle region (ARP31837_T100)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP31837_T100-FITC Conjugated

ARP31837_T100-HRP Conjugated

ARP31837_T100-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-137039 from Santa Cruz Biotechnology.
The immunogen is a synthetic peptide directed towards the middle region of human EBF3
Protein A purified
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-EBF3 (ARP31837_T100)
Peptide Sequence:
Synthetic peptide located within the following region: AHTGMMGVNSFSSQLAVNVSETSQANDQVGYSRNTSSVSPRGYVPSSTPQ
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-EBF3 (ARP31837_T100) antibody is Catalog # AAP31837 (Previous Catalog # AAPP02632)
Printable datasheet for anti-EBF3 (ARP31837_T100) antibody
Target Reference:
Ota,T., et al., (2004) Nat. Genet. 36 (1), 40-45

Bennett, K. L., Romigh, T. & Eng, C. Disruption of transforming growth factor-beta signaling by five frequently methylated genes leads to head and neck squamous cell carcinoma pathogenesis. Cancer Res. 69, 9301-5 (2009). WB, Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish 19934318

Gene Symbol:
Official Gene Full Name:
Early B-cell factor 3
Alias Symbols:
COE3, OE-2, EBF-3, O/E-2
NCBI Gene Id:
Protein Name:
Transcription factor COE3
Description of Target:
EB1 family proteins are evolutionarily conserved proteins that bind microtubule plus-ends and centrosomes and regulate the dynamics and organization of microtubules. Human EB1 family proteins, which include EB1, EBF3, and RP1, also associate with the tumor suppressor protein adenomatous polyposis coli (APC) and p150glued, a component of the dynactin complex.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Size (# AA):
Molecular Weight:
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express EBF3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express EBF3.
Protein Interactions:

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...