Size:100 ul
Special Price $229.00 Regular Price $319.00
In stock
SKU
ARP39578_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP39578_P050-FITC Conjugated

ARP39578_P050-HRP Conjugated

ARP39578_P050-Biotin Conjugated

EBF1 Antibody (ARP39578_P050)

Catalog#: ARP39578_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-115802 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards (50ug) human EBF1.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology dataAnti-EBF1 (ARP39578_P050)
Peptide SequenceSynthetic peptide located within the following region: LPSNCSSSSGIFSFSPANMVSAVKQKSAFAPVVRPQTSPPPTCTSTNGNS
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-EBF1 (ARP39578_P050) antibody is Catalog # AAP39578 (Previous Catalog # AAPP21591)
Datasheets/ManualsPrintable datasheet for anti-EBF1 (ARP39578_P050) antibody
Gene SymbolEBF1
Alias SymbolsEBF, COE1, OLF1, O/E-1
NCBI Gene Id1879
Protein NameTranscription factor COE1
Swissprot IdQ9UH73
Protein Size (# AA)591
Molecular Weight64kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express EBF1.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express EBF1.
Protein InteractionsATPAF2; HOMEZ; BCL6; ZNF521; ZNF423; CREBBP; PAX5; EBF1;
Write Your Own Review
You're reviewing:EBF1 Antibody (ARP39578_P050)
Your Rating
Aviva Travel Grant
Aviva ChIP Antibodies
Aviva Tips and Tricks
Aviva Live Chat