Search Antibody, Protein, and ELISA Kit Solutions

EBF1 Antibody (ARP39578_P050)

100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP39578_P050-FITC Conjugated

ARP39578_P050-HRP Conjugated

ARP39578_P050-Biotin Conjugated

Gene Symbol:
EBF1
NCBI Gene Id:
1879
Protein Name:
Transcription factor COE1
Swissprot Id:
Q9UH73
Alias Symbols:
EBF, COE1, OLF1, O/E-1
Replacement Item:
This antibody may replace item sc-115802 from Santa Cruz Biotechnology.
Protein Size (# AA):
591
Molecular Weight:
64kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express EBF1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express EBF1.
Immunogen:
The immunogen is a synthetic peptide directed towards (50ug) human EBF1.
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-EBF1 (ARP39578_P050)
Peptide Sequence:
Synthetic peptide located within the following region: LPSNCSSSSGIFSFSPANMVSAVKQKSAFAPVVRPQTSPPPTCTSTNGNS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
ATPAF2; HOMEZ; BCL6; ZNF521; ZNF423; CREBBP; PAX5; EBF1;
Blocking Peptide:
For anti-EBF1 (ARP39578_P050) antibody is Catalog # AAP39578 (Previous Catalog # AAPP21591)
Datasheets/Manuals:
Printable datasheet for anti-EBF1 (ARP39578_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...