- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for EAAT2 Antibody (OABB02116) |
---|
Tested Species Reactivity | Human, Mouse, Rat |
---|---|
Predicted Species Reactivity | Mouse|Rat |
Product Format | Lyophilized. Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2mg Na2HPO4, 0.05 mg NaN3. |
Clonality | Polyclonal |
Clone | Polyclonal |
Isotype | Rabbit IgG |
Host | Rabbit |
Application | Immunofluorescence|Immunohistochemistry|Western blot |
Additional Information | Notes: WB: The detection limit for EAAT2 is approximately 0.1ng/lane under reducing conditions. Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. |
:: | Background: SLC1A2 is also known as EAAT2 or GLT-1. This gene encodes a member of a family of solute transporter proteins. The membrane-bound protein is the principal transporter that clears the excitatory neurotransmitter glutamate from the extracellular space at synapses in the central nervous system. Glutamate clearance is necessary for proper synaptic activation and to prevent neuronal damage from excessive activation of glutamate receptors. Mutations in and decreased expression of this protein are associated with amyotrophic lateral sclerosis. Alternatively spliced transcript variants of this gene have been identified. |
Reconstitution and Storage | 2°C to 8°C|-20°C |
Immunogen | E.coli-derived human EAAT2 recombinant protein (Position: T461-K574). Human EAAT2 shares 96% amino acid (aa) sequence identity with both mouse and rat EAAT2. |
Purification | Affinity Purified |
Peptide Sequence | TEDISLLVAVDWLLDRMRTSVNVVGDSFGAGIVYHLSKSELDTIDSQHRVHEDIEMTKTQSIYDDMKNHRESNSNQCVYAAHNSVIVDECKVTLAANGKSADCSVEEEPWKREK |
Concentration | 500 ug/ml |
Specificity | No cross reactivity with other proteins. |
Application Info | Western blot: 0.1-0.5 ug/ml: Human, Mouse, Rat |
Reference | 1. Jiménez-Jiménez FJ, et al. The solute carrier family 1 (glial high affinity glutamate transporter), member 2 gene, SLC1A2, rs3794087 variant and assessment risk for restless legs syndrome. Sleep Med, 2014 Feb. 2. Poletti S, et al. Effect of early stress on hippocampal gray matter is influenced by a functional polymorphism in EAAT2 in bipolar disorder. Prog Neuropsychopharmacol Biol Psychiatry, 2014 Jun 3. 3. Tanaka K. Role of glutamate transporters in the pathophysiology of major mental illnesses. Nihon Yakurigaku Zasshi, 2013 Dec. |
Storage Buffer | Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3. |
Description | Rabbit IgG polyclonal antibody for Excitatory amino acid transporter 2(SLC1A2) detection. Tested with WB in Human;Mouse;Rat. |
Gene Symbol | SLC1A2 |
---|---|
Gene Full Name | solute carrier family 1 member 2 |
Alias Symbols | DEE41;EAAT2;EIEE41;excitatory amino acid transporter 2;excitotoxic amino acid transporter 2;GLT-1;glutamate/aspartate transporter II;HBGT;sodium-dependent glutamate/aspartate transporter 2;solute carrier family 1 (glial high affinity glutamate transporter), member 2;Solute carrier family 1 member 2. |
NCBI Gene Id | 6506 |
Protein Name | Excitatory amino acid transporter 2 |
Description of Target | Sodium-dependent, high-affinity amino acid transporter that mediates the uptake of L-glutamate and also L-aspartate and D-aspartate (PubMed:7521911, PubMed:14506254, PubMed:15265858, PubMed:26690923). Functions as a symporter that transports one amino acid molecule together with two or three Na(+) ions and one proton, in parallel with the counter-transport of one K(+) ion (PubMed:14506254). Mediates Cl(-) flux that is not coupled to amino acid transport; this avoids the accumulation of negative charges due to aspartate and Na(+) symport (PubMed:14506254). Essential for the rapid removal of released glutamate from the synaptic cleft, and for terminating the postsynaptic action of glutamate (By similarity). |
Uniprot ID | P43004 |
Molecular Weight | 62104 MW |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "EAAT2 Antibody (OABB02116)"?
The tested species reactivity for this item is "Human, Mouse, Rat". This antibody is predicted to have homology to "Mouse|Rat".
-
How long will it take to receive "EAAT2 Antibody (OABB02116)"?
This item is available "Domestic: within 1-2 week delivery | International: within 1-2 week delivery".
-
What buffer format is "EAAT2 Antibody (OABB02116)" provided in?
This item is provided in "Lyophilized. Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2mg Na2HPO4, 0.05 mg NaN3.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "EAAT2 Antibody (OABB02116)"?
This target may also be called "DEE41;EAAT2;EIEE41;excitatory amino acid transporter 2;excitotoxic amino acid transporter 2;GLT-1;glutamate/aspartate transporter II;HBGT;sodium-dependent glutamate/aspartate transporter 2;solute carrier family 1 (glial high affinity glutamate transporter), member 2;Solute carrier family 1 member 2." in publications.
-
What is the shipping cost for "EAAT2 Antibody (OABB02116)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "EAAT2 Antibody (OABB02116)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "EAAT2 Antibody (OABB02116)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "62104 MW".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "EAAT2 Antibody (OABB02116)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "SLC1A2"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "SLC1A2"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "SLC1A2"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "SLC1A2"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "SLC1A2"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "SLC1A2"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.