EAAT2 Antibody (OABB02116)

Catalog No: OABB02116

Size:100UG

Click here to learn more about Aviva's By-Request Conjugation Service.

Anti-EAAT2 antibody, OABB02116, Western blotting
All lanes: Anti EAAT2 (OABB02116) at 0.5ug/ml
Lane 1: Rat Brain Tissue Lysate at 50ug
Lane 2: Mouse Brain Tissue Lysate at 50ug
Lane 3: U87 Whole Cell Lysate at 40ug
Lane 4: SMMC Whole Cell Lysate at 40ug
Lane 5: PANC Whole Cell Lysate at 40ug
Lane 6: A549 Whole Cell Lysate at 40ug
Predicted bind size: 62KD
Observed bind size: 62KD

Product Info

• Tested Species Reactivity: Human, Mouse, Rat
• Predicted Species Reactivity: Mouse|Rat
• Product Format: Lyophilized. Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2mg Na2HPO4, 0.05 mg NaN3.
• Clonality: Polyclonal
• Clone: Polyclonal
• Isotype: Rabbit IgG
• Host: Rabbit
• Application: Immunofluorescence|Immunohistochemistry|Western blot
• Additional Information: Notes: WB: The detection limit for EAAT2 is approximately 0.1ng/lane under reducing conditions.
  Tested Species: In-house tested species with positive results.
  Other applications have not been tested.
  Optimal dilutions should be determined by end users.
  
  Background: SLC1A2 is also known as EAAT2 or GLT-1. This gene encodes a member of a family of solute transporter proteins. The membrane-bound protein is the principal transporter that clears the excitatory neurotransmitter glutamate from the extracellular space at synapses in the central nervous system. Glutamate clearance is necessary for proper synaptic activation and to prevent neuronal damage from excessive activation of glutamate receptors. Mutations in and decreased expression of this protein are associated with amyotrophic lateral sclerosis. Alternatively spliced transcript variants of this gene have been identified.
• Reconstitution and Storage: 2°C to 8°C|-20°C
• Immunogen: E.coli-derived human EAAT2 recombinant protein (Position: T461-K574). Human EAAT2 shares 96% amino acid (aa) sequence identity with both mouse and rat EAAT2.
• Purification: Affinity Purified
• Peptide Sequence: TEDISLLVAVDWLLDRMRTSVNVVGDSFGAGIVYHLSKSELDTIDSQHRVHEDIEMTKTQSIYDDMKNHRESNSNQCVYAAHNSVIVDECKVTLAANGKSADCSVEEEPWKREK
• Concentration: 500 ug/ml
• Specificity: No cross reactivity with other proteins.
• Application Info: Western blot: 0.1-0.5 ug/ml: Human, Mouse, Rat
• Reference: 1. Jiménez-Jiménez FJ, et al. The solute carrier family 1 (glial high affinity glutamate transporter), member 2 gene, SLC1A2, rs3794087 variant and assessment risk for restless legs syndrome. Sleep Med, 2014 Feb.
  2. Poletti S, et al. Effect of early stress on hippocampal gray matter is influenced by a functional polymorphism in EAAT2 in bipolar disorder. Prog Neuropsychopharmacol Biol Psychiatry, 2014 Jun 3.
  3. Tanaka K. Role of glutamate transporters in the pathophysiology of major mental illnesses. Nihon Yakurigaku Zasshi, 2013 Dec.
  
• Storage Buffer: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Description: Rabbit IgG polyclonal antibody for Excitatory amino acid transporter 2(SLC1A2) detection. Tested with WB in Human;Mouse;Rat.

Target Info

• Gene Symbol: SLC1A2
• Gene Full Name: solute carrier family 1 member 2
• Alias Symbols: DEE41;EAAT2;EIEE41;excitatory amino acid transporter 2;excitotoxic amino acid transporter 2;GLT-1;glutamate/aspartate transporter II;HBGT;sodium-dependent glutamate/aspartate transporter 2;solute carrier family 1 (glial high affinity glutamate transporter), member 2;Solute carrier family 1 member 2.
• NCBI Gene Id: 6506
• Protein Name: Excitatory amino acid transporter 2
• Description of Target: Sodium-dependent, high-affinity amino acid transporter that mediates the uptake of L-glutamate and also L-aspartate and D-aspartate (PubMed:7521911, PubMed:14506254, PubMed:15265858, PubMed:26690923). Functions as a symporter that transports one amino acid molecule together with two or three Na(+) ions and one proton, in parallel with the counter-transport of one K(+) ion (PubMed:14506254). Mediates Cl(-) flux that is not coupled to amino acid transport; this avoids the accumulation of negative charges due to aspartate and Na(+) symport (PubMed:14506254). Essential for the rapid removal of released glutamate from the synaptic cleft, and for terminating the postsynaptic action of glutamate (By similarity).
• Uniprot ID: P43004
• Molecular Weight: 62104 MW