Aviva Systems Biology office will be closed for Memorial Day - May 27, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

E2F3 Antibody - C-terminal region : FITC (ARP38089_P050-FITC)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP38089_P050 Unconjugated

ARP38089_P050-HRP Conjugated

ARP38089_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
E2F transcription factor 3
NCBI Gene Id:
Protein Name:
Putative uncharacterized protein DKFZp686C18211 EMBL CAH18140.1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-22822 from Santa Cruz Biotechnology.
Description of Target:
E2F3 is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. The E2F proteins contain several evolutionally conserved domains found in most members of the family. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein and another 2 members, E2F1 and E2F2, have an additional cyclin binding domain. E2F3 binds specifically to retinoblastoma protein pRB in a cell-cycle dependent manner.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express E2F3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express E2F3.
The immunogen is a synthetic peptide directed towards the C terminal region of human E2F3
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 92%; Rat: 100%
Complete computational species homology data:
Anti-E2F3 (ARP38089_P050)
Peptide Sequence:
Synthetic peptide located within the following region: LLQQTEDQIPSNLEGPFVNLLPPLLQEDYLLSLGEEEGISDLFDAYDLEK
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-E2F3 (ARP38089_P050-FITC) antibody is Catalog # AAP38089 (Previous Catalog # AAPP20263)
Printable datasheet for anti-E2F3 (ARP38089_P050-FITC) antibody
The immunizing peptide used to raise this antibody is 100% homologous to isoform 2 (334aa, 37kDa) of human E2F3.
FITC (FAM): Excitation 495 nm/ Emission 520 nm
Target Reference:
Koehrer,K., et al., (2004) The German cDNA Consortium

Naga Prasad, S. V et al. Unique microRNA profile in end-stage heart failure indicates alterations in specific cardiovascular signaling networks. J. Biol. Chem. 284, 27487-99 (2009). WB, IHC, Rat, Bovine, Pig, Horse, Guinea pig, Dog, Human, Mouse, Rabbit 19641226

Melcher, R. et al. LOH and copy neutral LOH (cnLOH) act as alternative mechanism in sporadic colorectal cancers with chromosomal and microsatellite instability. Carcinogenesis 32, 636-42 (2011). WB, IHC, Rat, Bovine, Pig, Horse, Guinea pig, Dog, Human, Mouse, Rabbit 21297112

Giangreco, A. A. et al. Tumor suppressor microRNAs, miR-100 and -125b, are regulated by 1,25-dihydroxyvitamin D in primary prostate cells and in patient tissue. Cancer Prev. Res. (Phila). 6, 483-94 (2013). WB, IHC, Rat, Bovine, Pig, Horse, Guinea pig, Dog, Human, Mouse, Rabbit 23503652

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...