Size:100 ul
$319.00
In Stock
SKU
ARP38089_P050-FITC
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP38089_P050 Unconjugated

ARP38089_P050-HRP Conjugated

ARP38089_P050-Biotin Conjugated

E2F3 Antibody - C-terminal region : FITC (ARP38089_P050-FITC)

Catalog#: ARP38089_P050-FITC
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Clonality Polyclonal
Host Rabbit
Conjugation FITC (FAM): Excitation 495 nm/ Emission 520 nm
Application WB
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Replacement Item This antibody may replace item sc-22822 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human E2F3
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 92%; Rat: 100%
Complete computational species homology data Anti-E2F3 (ARP38089_P050)
Peptide Sequence Synthetic peptide located within the following region: LLQQTEDQIPSNLEGPFVNLLPPLLQEDYLLSLGEEEGISDLFDAYDLEK
Concentration 0.5 mg/ml
Blocking Peptide For anti-E2F3 (ARP38089_P050-FITC) antibody is Catalog # AAP38089 (Previous Catalog # AAPP20263)
Datasheets/Manuals Printable datasheet for anti-E2F3 (ARP38089_P050-FITC) antibody
Specificity The immunizing peptide used to raise this antibody is 100% homologous to isoform 2 (334aa, 37kDa) of human E2F3.
Target Reference Koehrer,K., et al., (2004) The German cDNA Consortium
Publications

Naga Prasad, S. V et al. Unique microRNA profile in end-stage heart failure indicates alterations in specific cardiovascular signaling networks. J. Biol. Chem. 284, 27487-99 (2009). WB, IHC, Rat, Bovine, Pig, Horse, Guinea pig, Dog, Human, Mouse, Rabbit 19641226

Melcher, R. et al. LOH and copy neutral LOH (cnLOH) act as alternative mechanism in sporadic colorectal cancers with chromosomal and microsatellite instability. Carcinogenesis 32, 636-42 (2011). WB, IHC, Rat, Bovine, Pig, Horse, Guinea pig, Dog, Human, Mouse, Rabbit 21297112

Giangreco, A. A. et al. Tumor suppressor microRNAs, miR-100 and -125b, are regulated by 1,25-dihydroxyvitamin D in primary prostate cells and in patient tissue. Cancer Prev. Res. (Phila). 6, 483-94 (2013). WB, IHC, Rat, Bovine, Pig, Horse, Guinea pig, Dog, Human, Mouse, Rabbit 23503652

Gene Symbol E2F3
Official Gene Full Name E2F transcription factor 3
Alias Symbols E2F-3
NCBI Gene Id 1871
Protein Name Putative uncharacterized protein DKFZp686C18211 EMBL CAH18140.1
Description of Target E2F3 is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. The E2F proteins contain several evolutionally conserved domains found in most members of the family. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein and another 2 members, E2F1 and E2F2, have an additional cyclin binding domain. E2F3 binds specifically to retinoblastoma protein pRB in a cell-cycle dependent manner.
Swissprot Id Q68DT0
Protein Accession # CAH18140
Nucleotide Accession # NM_001243076
Protein Size (# AA) 465
Molecular Weight 49kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express E2F3.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express E2F3.
Protein Interactions RB1; TRIM28; TFDP1; HDAC1; SRA1; RBL1; FZR1; ELAVL1; PCNA; MCM4; HELLS; CCNB1; BCL6; ATAD2; HCFC1; USF1; KMT2D; RYBP; TFDP2; YY1; TFE3; SP1; CCNA2; CDK3; RNF144A; FHL2; WNK1; MGA; TEAD3; SPIB; PKIB; MYBL2; CREBBP; EAPP; JMY; PPP1R13B; TP53BP2; TP53INP1; B
  1. What is the species homology for "E2F3 Antibody - C-terminal region : FITC (ARP38089_P050-FITC)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat".

  2. How long will it take to receive "E2F3 Antibody - C-terminal region : FITC (ARP38089_P050-FITC)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "E2F3 Antibody - C-terminal region : FITC (ARP38089_P050-FITC)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "E2F3 Antibody - C-terminal region : FITC (ARP38089_P050-FITC)"?

    This target may also be called "E2F-3" in publications.

  5. What is the shipping cost for "E2F3 Antibody - C-terminal region : FITC (ARP38089_P050-FITC)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "E2F3 Antibody - C-terminal region : FITC (ARP38089_P050-FITC)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "E2F3 Antibody - C-terminal region : FITC (ARP38089_P050-FITC)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "49kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "E2F3 Antibody - C-terminal region : FITC (ARP38089_P050-FITC)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "E2F3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "E2F3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "E2F3"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "E2F3"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "E2F3"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "E2F3"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:E2F3 Antibody - C-terminal region : FITC (ARP38089_P050-FITC)
Your Rating
We found other products you might like!