Search Antibody, Protein, and ELISA Kit Solutions

E2F3 Antibody - C-terminal region (ARP38089_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP38089_P050-FITC Conjugated

ARP38089_P050-HRP Conjugated

ARP38089_P050-Biotin Conjugated

Tested Species Reactivity:
Human, Mouse
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
E2F transcription factor 3
NCBI Gene Id:
Protein Name:
Putative uncharacterized protein DKFZp686C18211 EMBL CAH18140.1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-22822 from Santa Cruz Biotechnology.
Description of Target:
E2F3 is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. The E2F proteins contain several evolutionally conserved domains found in most members of the family. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein and another 2 members, E2F1 and E2F2, have an additional cyclin binding domain. E2F3 binds specifically to retinoblastoma protein pRB in a cell-cycle dependent manner.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express E2F3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express E2F3.
The immunogen is a synthetic peptide directed towards the C terminal region of human E2F3
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 92%; Rat: 100%
Complete computational species homology data:
Anti-E2F3 (ARP38089_P050)
Peptide Sequence:
Synthetic peptide located within the following region: LLQQTEDQIPSNLEGPFVNLLPPLLQEDYLLSLGEEEGISDLFDAYDLEK
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-E2F3 (ARP38089_P050) antibody is Catalog # AAP38089 (Previous Catalog # AAPP20263)
Printable datasheet for anti-E2F3 (ARP38089_P050) antibody
The immunizing peptide used to raise this antibody is 100% homologous to isoform 2 (334aa, 37kDa) of human E2F3.
Target Reference:
Koehrer,K., et al., (2004) The German cDNA Consortium

Giangreco, A. A. et al. Tumor suppressor microRNAs, miR-100 and -125b, are regulated by 1,25-dihydroxyvitamin D in primary prostate cells and in patient tissue. Cancer Prev. Res. (Phila). 6, 483-94 (2013). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 23503652

Melcher, R. et al. LOH and copy neutral LOH (cnLOH) act as alternative mechanism in sporadic colorectal cancers with chromosomal and microsatellite instability. Carcinogenesis 32, 636-42 (2011). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 21297112

Naga Prasad, S. V et al. Unique microRNA profile in end-stage heart failure indicates alterations in specific cardiovascular signaling networks. J. Biol. Chem. 284, 27487-99 (2009). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 19641226

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...