Loading...
Catalog No: ARP38089_P050
Price: $0.00
SKU
ARP38089_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-E2F3 (ARP38089_P050) antibody
Product Info
Tested Species ReactivityHuman, Mouse
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human E2F3
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 92%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: LLQQTEDQIPSNLEGPFVNLLPPLLQEDYLLSLGEEEGISDLFDAYDLEK
Concentration0.5 mg/ml
Blocking PeptideFor anti-E2F3 (ARP38089_P050) antibody is Catalog # AAP38089 (Previous Catalog # AAPP20263)
SpecificityThe immunizing peptide used to raise this antibody is 100% homologous to isoform 2 (334aa, 37kDa) of human E2F3.
Enhanced Validation
WBY
SPR
YCHAROS
ReferenceKoehrer,K., et al., (2004) The German cDNA Consortium
Publications

Giangreco, A. A. et al. Tumor suppressor microRNAs, miR-100 and -125b, are regulated by 1,25-dihydroxyvitamin D in primary prostate cells and in patient tissue. Cancer Prev. Res. (Phila). 6, 483-94 (2013). 23503652

Melcher, R. et al. LOH and copy neutral LOH (cnLOH) act as alternative mechanism in sporadic colorectal cancers with chromosomal and microsatellite instability. Carcinogenesis 32, 636-42 (2011). 21297112

Naga Prasad, S. V et al. Unique microRNA profile in end-stage heart failure indicates alterations in specific cardiovascular signaling networks. J. Biol. Chem. 284, 27487-99 (2009). 19641226

Gene SymbolE2F3
Gene Full NameE2F transcription factor 3
Alias SymbolsE2F-3
NCBI Gene Id1871
Protein NamePutative uncharacterized protein DKFZp686C18211 EMBL CAH18140.1
Description of TargetE2F3 is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. The E2F proteins contain several evolutionally conserved domains found in most members of the family. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein and another 2 members, E2F1 and E2F2, have an additional cyclin binding domain. E2F3 binds specifically to retinoblastoma protein pRB in a cell-cycle dependent manner.
Uniprot IDQ68DT0
Protein Accession #CAH18140
Nucleotide Accession #NM_001243076
Protein Size (# AA)465
Molecular Weight49 kDa
Protein InteractionsRB1; TRIM28; TFDP1; HDAC1; SRA1; RBL1; FZR1; ELAVL1; PCNA; MCM4; HELLS; CCNB1; BCL6; ATAD2; HCFC1; USF1; KMT2D; RYBP; TFDP2; YY1; TFE3; SP1; CCNA2; CDK3; RNF144A; FHL2; WNK1; MGA; TEAD3; SPIB; PKIB; MYBL2; CREBBP; EAPP; JMY; PPP1R13B; TP53BP2; TP53INP1; B
  1. What is the species homology for "E2F3 Antibody - C-terminal region (ARP38089_P050)"?

    The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "E2F3 Antibody - C-terminal region (ARP38089_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "E2F3 Antibody - C-terminal region (ARP38089_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "E2F3 Antibody - C-terminal region (ARP38089_P050)"?

    This target may also be called "E2F-3" in publications.

  5. What is the shipping cost for "E2F3 Antibody - C-terminal region (ARP38089_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "E2F3 Antibody - C-terminal region (ARP38089_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "E2F3 Antibody - C-terminal region (ARP38089_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "49 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "E2F3 Antibody - C-terminal region (ARP38089_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "E2F3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "E2F3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "E2F3"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "E2F3"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "E2F3"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "E2F3"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:E2F3 Antibody - C-terminal region (ARP38089_P050)
Your Rating
We found other products you might like!