Search Antibody, Protein, and ELISA Kit Solutions

E2F2 Antibody - middle region : FITC (ARP38418_P050-FITC)

100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP38418_P050 Unconjugated

ARP38418_P050-HRP Conjugated

ARP38418_P050-Biotin Conjugated

Gene Symbol:
E2F2
Official Gene Full Name:
E2F transcription factor 2
NCBI Gene Id:
1870
Protein Name:
Transcription factor E2F2
Swissprot Id:
Q14209
Protein Accession #:
NP_004082
Nucleotide Accession #:
NM_004091
Alias Symbols:
E2F-2
Replacement Item:
This antibody may replace item sc-22821 from Santa Cruz Biotechnology.
Description of Target:
E2F2 is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. The E2F proteins contain several evolutionally conserved domains found in most members of the family. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein and another 2 members, E2F1 and E2F3, have an additional cyclin binding domain. This protein binds specifically to retinoblastoma protein pRB in a cell-cycle dependent manner, and it exhibits overall 46% amino acid identity to E2F1.The protein encoded by this gene is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. The E2F proteins contain several evolutionally conserved domains found in most members of the family. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein and another 2 members, E2F1 and E2F3, have an additional cyclin binding domain. This protein binds specifically to retinoblastoma protein pRB in a cell-cycle dependent manner, and it exhibits overall 46% amino acid identity to E2F1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
437
Molecular Weight:
47kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express E2F2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express E2F2.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human E2F2
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 92%; Dog: 100%; Guinea Pig: 91%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 75%
Complete computational species homology data:
Anti-E2F2 (ARP38418_P050)
Peptide Sequence:
Synthetic peptide located within the following region: DQFLSPTLACSSPLISFSPSLDQDDYLWGLEAGEGISDLFDSYDLGDLLI
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
0.5 mg/ml
Protein Interactions:
RB1; GNB5; GIT2; TFDP1; RBL1; ARID3A; ELAVL1; ATAD2; KMT2D; KMT2A; RYBP; SETD8; BCAR1; TFDP2; BRD2; YY1; SP1; CDK3; RNF144A; FHL2; SPIB; RBL2; E2F4; MYBL2; EAPP; TP53BP2; PPP1R13B; TP53INP1; JMY; GAB2; CDC25A; CDC6; E2F1; UXT; MT1G;
Blocking Peptide:
For anti-E2F2 (ARP38418_P050-FITC) antibody is Catalog # AAP38418 (Previous Catalog # AAPP20608)
Datasheets/Manuals:
Printable datasheet for anti-E2F2 (ARP38418_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm
Target Reference:
Raj,D., (2008) Carcinogenesis 29 (1), 194-201

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...