Size:100 ul
Special Price $229.00 Regular Price $319.00
In Stock
SKU
ARP38418_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP38418_P050-FITC Conjugated

ARP38418_P050-HRP Conjugated

ARP38418_P050-Biotin Conjugated

E2F2 Antibody - middle region (ARP38418_P050)

Catalog#: ARP38418_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human, Mouse
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-22821 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human E2F2
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 92%; Dog: 100%; Guinea Pig: 91%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 75%
Complete computational species homology data Anti-E2F2 (ARP38418_P050)
Peptide Sequence Synthetic peptide located within the following region: DQFLSPTLACSSPLISFSPSLDQDDYLWGLEAGEGISDLFDSYDLGDLLI
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-E2F2 (ARP38418_P050) antibody is Catalog # AAP38418 (Previous Catalog # AAPP20608)
Datasheets/Manuals Printable datasheet for anti-E2F2 (ARP38418_P050) antibody
Target Reference Raj,D., (2008) Carcinogenesis 29 (1), 194-201
Gene Symbol E2F2
Official Gene Full Name E2F transcription factor 2
Alias Symbols E2F-2
NCBI Gene Id 1870
Protein Name Transcription factor E2F2
Description of Target E2F2 is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. The E2F proteins contain several evolutionally conserved domains found in most members of the family. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein and another 2 members, E2F1 and E2F3, have an additional cyclin binding domain. This protein binds specifically to retinoblastoma protein pRB in a cell-cycle dependent manner, and it exhibits overall 46% amino acid identity to E2F1.The protein encoded by this gene is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. The E2F proteins contain several evolutionally conserved domains found in most members of the family. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein and another 2 members, E2F1 and E2F3, have an additional cyclin binding domain. This protein binds specifically to retinoblastoma protein pRB in a cell-cycle dependent manner, and it exhibits overall 46% amino acid identity to E2F1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot Id Q14209
Protein Accession # NP_004082
Nucleotide Accession # NM_004091
Protein Size (# AA) 437
Molecular Weight 47kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express E2F2.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express E2F2.
Protein Interactions RB1; GNB5; GIT2; TFDP1; RBL1; ARID3A; ELAVL1; ATAD2; KMT2D; KMT2A; RYBP; SETD8; BCAR1; TFDP2; BRD2; YY1; SP1; CDK3; RNF144A; FHL2; SPIB; RBL2; E2F4; MYBL2; EAPP; TP53BP2; PPP1R13B; TP53INP1; JMY; GAB2; CDC25A; CDC6; E2F1; UXT; MT1G;
  1. What is the species homology for "E2F2 Antibody - middle region (ARP38418_P050)"?

    The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish".

  2. How long will it take to receive "E2F2 Antibody - middle region (ARP38418_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "E2F2 Antibody - middle region (ARP38418_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "E2F2 Antibody - middle region (ARP38418_P050)"?

    This target may also be called "E2F-2" in publications.

  5. What is the shipping cost for "E2F2 Antibody - middle region (ARP38418_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "E2F2 Antibody - middle region (ARP38418_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "E2F2 Antibody - middle region (ARP38418_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "47kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "E2F2 Antibody - middle region (ARP38418_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "E2F2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "E2F2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "E2F2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "E2F2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "E2F2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "E2F2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:E2F2 Antibody - middle region (ARP38418_P050)
Your Rating
We found other products you might like!