Search Antibody, Protein, and ELISA Kit Solutions

DYRK2 Antibody - middle region : FITC (ARP74502_P050-FITC)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP74502_P050 Unconjugated

ARP74502_P050-HRP Conjugated

ARP74502_P050-Biotin Conjugated

Gene Symbol:
DYRK2
NCBI Gene Id:
8445
Swissprot Id:
Q92630-2
Alias Symbols:
DYRK2,
Replacement Item:
This antibody may replace item sc-158464 from Santa Cruz Biotechnology.
Description of Target:
DYRK2 belongs to a family of protein kinases whose members are presumed to be involved in cellular growth and/or development. The family is defined by structural similarity of their kinase domains and their capability to autophosphorylate on tyrosine residues. DYRK2 has demonstrated tyrosine autophosphorylation and catalyzed phosphorylation of histones H3 and H2B in vitro. Two isoforms of DYRK2 have been isolated. The predominant isoform, isoform 1, lacks a 5' terminal insert.
Protein Size (# AA):
528
Molecular Weight:
58kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express DYRK2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express DYRK2.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of Human DYRK2
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: EIFSYPEIYFLGLNAKKRQGMTGGPNNGGYDDDQGSYVQVPHDHVAYRYE
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
0.5 mg/ml
Protein Interactions:
SP100; WDR62; ZBTB9; LZTS2; KXD1; IKZF1; NR1I2; RB1CC1; DYRK4; DYRK2; TTN; HSP90AA1; TERT; APP; UBC; SIAH2; SSBP2; KATNA1; VPRBP; DAP3; TUBA3C; RPS2; RPLP0; RPL18; RPL7A; RPL7; RPL4; RPA1; SLC25A3; PDHB; PCMT1; NPM1; MDM2; HSPA8; HSPA6; HSPA5; HSPA1B; HSP
Blocking Peptide:
For anti-DYRK2 (ARP74502_P050-FITC) antibody is Catalog # AAP74502
Datasheets/Manuals:
Printable datasheet for anti-DYRK2 (ARP74502_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm
Target Reference:
N/A

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...