DYNLL2 Antibody - N-terminal region : FITC (ARP52514_P050-FITC)

Catalog No: ARP52514_P050-FITC

Size:100ul

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: FITC: Fluorescein Isothiocyanate
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DYNLL2
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
• Peptide Sequence: Synthetic peptide located within the following region: MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKY
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-DYNLL2 (ARP52514_P050-FITC) antibody is Catalog # AAP52514 (Previous Catalog # AAPP30428)

Target Info

• Reference: Pfister,K.K., (2005) J. Cell Biol. 171 (3), 411-413
• Gene Symbol: DYNLL2
• Gene Full Name: Dynein, light chain, LC8-type 2
• Alias Symbols: Dlc2, DNCL1B, RSPH22
• NCBI Gene Id: 140735
• Protein Name: Dynein light chain 2, cytoplasmic
• Description of Target: DYNLL2 belongs to the dynein light chain family. DYNLL2 may be involved in some aspects of dynein-related intracellular transport and motility. It may play a role in changing or maintaining the spatial distribution of cytoskeletal structures.
• Uniprot ID: Q96FJ2
• Protein Accession #: NP_542408
• Nucleotide Accession #: NM_080677
• Protein Size (# AA): 89
• Molecular Weight: 10kDa
• Protein Interactions: GPRIN2; MEOX2; SECISBP2L; CCDC36; C12orf40; MORN3; BMF; HMBOX1; RASGRP3; DNAL4; EED; DYRK1A; CSNK1A1; UL122; UBC; PAK1; Nek9; Cep152; Dynll1; Spag5; AMOT; THAP10; DLGAP1; HOMER3; GPHN; DYNC1I1; XIAP; MYO5A; EWSR1; DYNLL2; BCL2L11; DLG4; DLG2; SHANK2;