Search Antibody, Protein, and ELISA Kit Solutions

DYM Antibody - middle region (ARP84298_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
DYM
Official Gene Full Name:
dymeclin
NCBI Gene Id:
54808
Protein Name:
dymeclin
Swissprot Id:
Q7RTS9-2
Protein Accession #:
NP_060123.3
Nucleotide Accession #:
NM_017653.3
Alias Symbols:
DMC, SMC
Description of Target:
This gene encodes a protein which is necessary for normal skeletal development and brain function. Mutations in this gene are associated with two types of recessive osteochondrodysplasia, Dyggve-Melchior-Clausen (DMC) dysplasia and Smith-McCort (SMC) dysplasia, which involve both skeletal defects and mental retardation.
Protein Size (# AA):
479
Molecular Weight:
54 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express DYM.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express DYM.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human DYM
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: GSLLILVVIRTIQYNMTRTRDKYLHTNCLAALANMSAQFRSLHQYAAQRI
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-DYM (ARP84298_P050) antibody is Catalog # AAP84298
Datasheets/Manuals:
Printable datasheet for anti-DYM (ARP84298_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...