Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP84298_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

DYM Antibody - middle region (ARP84298_P050)

Catalog#: ARP84298_P050
Domestic: within 24 hours delivery | International: 3-5 business days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human DYM
PurificationAffinity purified
Peptide SequenceSynthetic peptide located within the following region: GSLLILVVIRTIQYNMTRTRDKYLHTNCLAALANMSAQFRSLHQYAAQRI
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-DYM (ARP84298_P050) antibody is Catalog # AAP84298
Datasheets/ManualsPrintable datasheet for anti-DYM (ARP84298_P050) antibody
Gene SymbolDYM
Official Gene Full Namedymeclin
Alias SymbolsDMC, SMC
NCBI Gene Id54808
Protein Namedymeclin
Description of TargetThis gene encodes a protein which is necessary for normal skeletal development and brain function. Mutations in this gene are associated with two types of recessive osteochondrodysplasia, Dyggve-Melchior-Clausen (DMC) dysplasia and Smith-McCort (SMC) dysplasia, which involve both skeletal defects and mental retardation.
Swissprot IdQ7RTS9-2
Protein Accession #NP_060123.3
Nucleotide Accession #NM_017653.3
Protein Size (# AA)479
Molecular Weight54 kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express DYM.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express DYM.
Write Your Own Review
You're reviewing:DYM Antibody - middle region (ARP84298_P050)
Your Rating
Aviva Blast Tool
Aviva Pathways
Free Microscope
Aviva ChIP Antibodies