DUX4 Antibody - middle region (ARP51120_P050)

Catalog No: ARP51120_P050

Host: Rabbit
Target Name: DUX4
Sample Type: THP-1 Whole cell lysates
Antibody Dilution: 1.0ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DUX4
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Human: 85%
• Peptide Sequence: Synthetic peptide located within the following region: ESRPWPGRRGPPEGRRKRTAVTGSQTALLLRAFEKDRFPGIAAREELARE
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-DUX4 (ARP51120_P050) antibody is Catalog # AAP51120

Target Info

• Gene Symbol: DUX4
• Gene Full Name: double homeobox 4
• Alias Symbols: DUX4L
• NCBI Gene Id: 100288687
• Protein Name: double homeobox protein 4
• Description of Target: This gene is located within a D4Z4 repeat array in the subtelomeric region of chromosome 4q. The D4Z4 repeat is polymorphic in length; a similar D4Z4 repeat array has been identified on chromosome 10. Each D4Z4 repeat unit has an open reading frame (named DUX4) that encodes two homeoboxes; the repeat-array and ORF is conserved in other mammals. The encoded protein has been reported to function as a transcriptional activator of paired-like homeodomain transcription factor 1 (PITX1; GeneID 5307). Contraction of the macrosatellite repeat causes autosomal dominant facioscapulohumeral muscular dystrophy (FSHD). Alternative splicing results in multiple transcript variants.
• Uniprot ID: Q9UBX2
• Protein Accession #: NP_001280727.1
• Nucleotide Accession #: NM_001293798.1
• Protein Size (# AA): 424
• Molecular Weight: 46kDa