SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP58225_P050-FITC
Size:100ul
Price: $434.00
SKU
ARP58225_P050-FITC
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

DUSP5 Antibody - middle region : FITC (ARP58225_P050-FITC)

Datasheets/ManualsPrintable datasheet for anti-DUSP5 (ARP58225_P050-FITC) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationFITC: Fluorescein Isothiocyanate
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human DUSP5
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 85%; Dog: 92%; Guinea Pig: 79%; Horse: 100%; Human: 100%; Mouse: 86%; Pig: 100%; Rabbit: 86%; Rat: 79%
Peptide SequenceSynthetic peptide located within the following region: AGSSLIGHLQTLSPDMQGAYCTFPASVLAPVPTHSTVSELSRSPVATATS
Concentration0.5 mg/ml
Blocking PeptideFor anti-DUSP5 (ARP58225_P050-FITC) antibody is Catalog # AAP58225 (Previous Catalog # AAPP33190)
Gene SymbolDUSP5
Gene Full NameDual specificity phosphatase 5
Alias SymbolsDUSP, HVH3
NCBI Gene Id1847
Protein NameDual specificity protein phosphatase 5
Description of TargetThe protein encoded by this gene is a member of the dual specificity protein phosphatase subfamily. These phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. They negatively regulate members of the mitogen-activated protein (MAP) kinase superfamily (MAPK/ERK, SAPK/JNK, p38), which are associated with cellular proliferation and differentiation. Different members of the family of dual specificity phosphatases show distinct substrate specificities for various MAP kinases, different tissue distribution and subcellular localization, and different modes of inducibility of their expression by extracellular stimuli. This gene product inactivates ERK1, is expressed in a variety of tissues with the highest levels in pancreas and brain, and is localized in the nucleus.
Uniprot IDQ16690
Protein Accession #NP_004410
Nucleotide Accession #NM_004419
Protein Size (# AA)384
Molecular Weight42kDa
Protein InteractionsELAVL1; UBC; MAPK3; MAPK1;
  1. What is the species homology for "DUSP5 Antibody - middle region : FITC (ARP58225_P050-FITC)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit".

  2. How long will it take to receive "DUSP5 Antibody - middle region : FITC (ARP58225_P050-FITC)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "DUSP5 Antibody - middle region : FITC (ARP58225_P050-FITC)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "DUSP5 Antibody - middle region : FITC (ARP58225_P050-FITC)"?

    This target may also be called "DUSP, HVH3" in publications.

  5. What is the shipping cost for "DUSP5 Antibody - middle region : FITC (ARP58225_P050-FITC)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "DUSP5 Antibody - middle region : FITC (ARP58225_P050-FITC)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "DUSP5 Antibody - middle region : FITC (ARP58225_P050-FITC)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "42kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "DUSP5 Antibody - middle region : FITC (ARP58225_P050-FITC)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "DUSP5"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "DUSP5"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "DUSP5"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "DUSP5"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "DUSP5"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "DUSP5"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:DUSP5 Antibody - middle region : FITC (ARP58225_P050-FITC)
Your Rating
We found other products you might like!