DUSP10 Antibody - middle region (ARP87710_P050)

Catalog No: ARP87710_P050

Host: Rabbit
Target Name: DUSP10
Sample Tissue: Human Jurkat Whole Cell lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DUSP10
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: PLYHYEKGLFNYKRLPATDSNKQNLRQYFEEAFEFIEEAHQCGKGLLIHC
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-DUSP10 (ARP87710_P050) antibody is Catalog # AAP87710

Target Info

• Gene Symbol: DUSP10
• Gene Full Name: dual specificity phosphatase 10
• Alias Symbols: MKP5, MKP-5
• NCBI Gene Id: 11221
• Protein Name: dual specificity protein phosphatase 10
• Description of Target: Dual specificity protein phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. They negatively regulate members of the MAP kinase superfamily, which is associated with cellular proliferation and differentiation. Different members of this family of dual specificity phosphatases show distinct substrate specificities for MAP kinases, different tissue distribution and subcellular localization, and different modes of expression induction by extracellular stimuli. This gene product binds to and inactivates p38 and SAPK/JNK. Alternative splicing results in multiple transcript variants.
• Uniprot ID: Q9Y6W6
• Protein Accession #: NP_009138.1
• Nucleotide Accession #: NM_007207.5
• Protein Size (# AA): 482
• Molecular Weight: 53 kDa