Search Antibody, Protein, and ELISA Kit Solutions

DTNBP1 Antibody - N-terminal region (ARP87402_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
DTNBP1
Official Gene Full Name:
dystrobrevin binding protein 1
NCBI Gene Id:
84062
Protein Name:
Dysbindin
Swissprot Id:
Q96EV8-2
Protein Accession #:
NP_001258596.1
Nucleotide Accession #:
NM_001271667.1
Alias Symbols:
SDY, DBND, HPS7, My031, BLOC1S8
Description of Target:
This gene encodes a protein that may play a role in organelle biogenesis associated with melanosomes, platelet dense granules, and lysosomes. A similar protein in mouse is a component of a protein complex termed biogenesis of lysosome-related organelles complex 1 (BLOC-1), and binds to alpha- and beta-dystrobrevins, which are components of the dystrophin-associated protein complex (DPC). Mutations in this gene are associated with Hermansky-Pudlak syndrome type 7. This gene may also be associated with schizophrenia. Multiple transcript variants encoding distinct isoforms have been identified for this gene.
Protein Size (# AA):
303
Molecular Weight:
35 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express DTNBP1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express DTNBP1.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human DTNBP1
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: ETLRERLLSVQQDFTSGLKTLSDKSREAKVKSKPRTVPFLPKYSAGLELL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-DTNBP1 (ARP87402_P050) antibody is Catalog # AAP87402
Datasheets/Manuals:
Printable datasheet for anti-DTNBP1 (ARP87402_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...