Size:100 ul
In Stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP45198_P050 Unconjugated

ARP45198_P050-FITC Conjugated

ARP45198_P050-Biotin Conjugated

DSG2 Antibody - N-terminal region : HRP (ARP45198_P050-HRP)

Catalog#: ARP45198_P050-HRP
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Product Format Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Clonality Polyclonal
Host Rabbit
Conjugation HRP
Application IHC, WB
Additional Information IHC Information: Pancreas, Human: Formalin-Fixed, Paraffin-Embedded (FFPE)
IHC Information: Pancreas, Human: Formalin-Fixed, Paraffin-Embedded (FFPE)
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Replacement Item This antibody may replace item sc-135815 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human DSG2
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%
Complete computational species homology data Anti-DSG2 (ARP45198_P050)
Peptide Sequence Synthetic peptide located within the following region: KIHSDLAEERGLKITYKYTGKGITEPPFGIFVFNKDTGELNVTSILDREE
Concentration 0.5 mg/ml
Blocking Peptide For anti-DSG2 (ARP45198_P050-HRP) antibody is Catalog # AAP45198 (Previous Catalog # AAPP26187)
Datasheets/Manuals Printable datasheet for anti-DSG2 (ARP45198_P050-HRP) antibody
Target Reference Cirillo,N., (2008) J. Cell. Biochem. 103 (2), 598-606

Hummitzsch, K. et al. A new model of development of the mammalian ovary and follicles. PLoS One 8, e55578 (2013). WB, ICC/IF, IHC, Rat, Pig, Human, Mouse, Bovine, Dog, Horse, Rabbit, Guinea pig 23409002

Gene Symbol DSG2
Official Gene Full Name Desmoglein 2
Alias Symbols ARVC10, ARVD10, CDHF5, HDGC, MGC117034, MGC117036, MGC117037, CMD1BB
NCBI Gene Id 1829
Protein Name Desmoglein-2
Description of Target Desmosomes are cell-cell junctions between epithelial, myocardial, and certain other cell types. DSG2 is a calcium-binding transmembrane glycoprotein component of desmosomes in vertebrate epithelial cells. Currently, three desmoglein subfamily members have been identified and all are members of the cadherin cell adhesion molecule superfamily. These desmoglein gene family members are located in a cluster on chromosome 18. This second family member is expressed in colon, colon carcinoma, and other simple and stratified epithelial-derived cell lines.Desmosomes are cell-cell junctions between epithelial, myocardial, and certain other cell types. This gene product is a calcium-binding transmembrane glycoprotein component of desmosomes in vertebrate epithelial cells. Currently, three desmoglein subfamily members have been identified and all are members of the cadherin cell adhesion molecule superfamily. These desmoglein gene family members are located in a cluster on chromosome 18. This second family member is expressed in colon, colon carcinoma, and other simple and stratified epithelial-derived cell lines. Mutations in this gene have been associated with arrhythmogenic right ventricular dysplasia, familial, 10. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot Id Q14126
Protein Accession # NP_001934
Nucleotide Accession # NM_001943
Protein Size (# AA) 1118
Molecular Weight 114kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express DSG2.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express DSG2.
Protein Interactions UBC; SART3; EED; ADRB2; PAN2; CHCHD2; PLIN3; Trim69; Cbx1; RYK; PKP3; PKP2; JUP; DSC2; DSC1;
  1. What is the species homology for "DSG2 Antibody - N-terminal region : HRP (ARP45198_P050-HRP)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat".

  2. How long will it take to receive "DSG2 Antibody - N-terminal region : HRP (ARP45198_P050-HRP)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "DSG2 Antibody - N-terminal region : HRP (ARP45198_P050-HRP)" provided in?

    This item is provided in "Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.".
    Additional format options may be available. For more information please contact

  4. What are other names for "DSG2 Antibody - N-terminal region : HRP (ARP45198_P050-HRP)"?

    This target may also be called "ARVC10, ARVD10, CDHF5, HDGC, MGC117034, MGC117036, MGC117037, CMD1BB" in publications.

  5. What is the shipping cost for "DSG2 Antibody - N-terminal region : HRP (ARP45198_P050-HRP)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "DSG2 Antibody - N-terminal region : HRP (ARP45198_P050-HRP)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "DSG2 Antibody - N-terminal region : HRP (ARP45198_P050-HRP)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "114kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "DSG2 Antibody - N-terminal region : HRP (ARP45198_P050-HRP)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "DSG2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "DSG2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "DSG2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "DSG2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "DSG2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "DSG2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:DSG2 Antibody - N-terminal region : HRP (ARP45198_P050-HRP)
Your Rating
We found other products you might like!