Search Antibody, Protein, and ELISA Kit Solutions

DSG2 Antibody - N-terminal region : HRP (ARP45198_P050-HRP)

100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP45198_P050 Unconjugated

ARP45198_P050-FITC Conjugated

ARP45198_P050-Biotin Conjugated

Gene Symbol:
DSG2
Official Gene Full Name:
Desmoglein 2
NCBI Gene Id:
1829
Protein Name:
Desmoglein-2
Swissprot Id:
Q14126
Protein Accession #:
NP_001934
Nucleotide Accession #:
NM_001943
Alias Symbols:
ARVC10, ARVD10, CDHF5, HDGC, MGC117034, MGC117036, MGC117037, CMD1BB
Replacement Item:
This antibody may replace item sc-135815 from Santa Cruz Biotechnology.
Description of Target:
Desmosomes are cell-cell junctions between epithelial, myocardial, and certain other cell types. DSG2 is a calcium-binding transmembrane glycoprotein component of desmosomes in vertebrate epithelial cells. Currently, three desmoglein subfamily members have been identified and all are members of the cadherin cell adhesion molecule superfamily. These desmoglein gene family members are located in a cluster on chromosome 18. This second family member is expressed in colon, colon carcinoma, and other simple and stratified epithelial-derived cell lines.Desmosomes are cell-cell junctions between epithelial, myocardial, and certain other cell types. This gene product is a calcium-binding transmembrane glycoprotein component of desmosomes in vertebrate epithelial cells. Currently, three desmoglein subfamily members have been identified and all are members of the cadherin cell adhesion molecule superfamily. These desmoglein gene family members are located in a cluster on chromosome 18. This second family member is expressed in colon, colon carcinoma, and other simple and stratified epithelial-derived cell lines. Mutations in this gene have been associated with arrhythmogenic right ventricular dysplasia, familial, 10. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
1118
Molecular Weight:
114kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express DSG2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express DSG2.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human DSG2
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%
Complete computational species homology data:
Anti-DSG2 (ARP45198_P050)
Peptide Sequence:
Synthetic peptide located within the following region: KIHSDLAEERGLKITYKYTGKGITEPPFGIFVFNKDTGELNVTSILDREE
Product Format:
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
0.6-0.7 mg/ml
Protein Interactions:
UBC; SART3; EED; ADRB2; PAN2; CHCHD2; PLIN3; Trim69; Cbx1; RYK; PKP3; PKP2; JUP; DSC2; DSC1;
Blocking Peptide:
For anti-DSG2 (ARP45198_P050-HRP) antibody is Catalog # AAP45198 (Previous Catalog # AAPP26187)
Datasheets/Manuals:
Printable datasheet for anti-DSG2 (ARP45198_P050-HRP) antibody
Conjugation:
HRP
Additional Information:
IHC Information: Pancreas, Human: Formalin-Fixed, Paraffin-Embedded (FFPE)
IHC Information: Pancreas, Human: Formalin-Fixed, Paraffin-Embedded (FFPE)
Target Reference:
Cirillo,N., (2008) J. Cell. Biochem. 103 (2), 598-606
Publications:

Hummitzsch, K. et al. A new model of development of the mammalian ovary and follicles. PLoS One 8, e55578 (2013). WB, ICC/IF, IHC, Rat, Pig, Human, Mouse, Bovine, Dog, Horse, Rabbit, Guinea pig 23409002

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...