SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP45198_P050-FITC
Size:100ul
Price: $434.00
SKU
ARP45198_P050-FITC
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

DSG2 Antibody - N-terminal region : FITC (ARP45198_P050-FITC)

Datasheets/ManualsPrintable datasheet for anti-DSG2 (ARP45198_P050-FITC) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationFITC: Fluorescein Isothiocyanate
ApplicationIHC, WB
Additional InformationIHC Information: Pancreas, Human: Formalin-Fixed, Paraffin-Embedded (FFPE)
IHC Information: Pancreas, Human: Formalin-Fixed, Paraffin-Embedded (FFPE)
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human DSG2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: KIHSDLAEERGLKITYKYTGKGITEPPFGIFVFNKDTGELNVTSILDREE
Concentration0.5 mg/ml
Blocking PeptideFor anti-DSG2 (ARP45198_P050-FITC) antibody is Catalog # AAP45198 (Previous Catalog # AAPP26187)
ReferenceCirillo,N., (2008) J. Cell. Biochem. 103 (2), 598-606
Publications

Hummitzsch, K. et al. A new model of development of the mammalian ovary and follicles. PLoS One 8, e55578 (2013). WB, ICC/IF, IHC, Rat, Pig, Human, Mouse, Bovine, Dog, Horse, Rabbit, Guinea pig 23409002

Gene SymbolDSG2
Gene Full NameDesmoglein 2
Alias SymbolsHDGC, CDHF5
NCBI Gene Id1829
Protein NameDesmoglein-2
Description of TargetDesmosomes are cell-cell junctions between epithelial, myocardial, and certain other cell types. DSG2 is a calcium-binding transmembrane glycoprotein component of desmosomes in vertebrate epithelial cells. Currently, three desmoglein subfamily members have been identified and all are members of the cadherin cell adhesion molecule superfamily. These desmoglein gene family members are located in a cluster on chromosome 18. This second family member is expressed in colon, colon carcinoma, and other simple and stratified epithelial-derived cell lines.Desmosomes are cell-cell junctions between epithelial, myocardial, and certain other cell types. This gene product is a calcium-binding transmembrane glycoprotein component of desmosomes in vertebrate epithelial cells. Currently, three desmoglein subfamily members have been identified and all are members of the cadherin cell adhesion molecule superfamily. These desmoglein gene family members are located in a cluster on chromosome 18. This second family member is expressed in colon, colon carcinoma, and other simple and stratified epithelial-derived cell lines. Mutations in this gene have been associated with arrhythmogenic right ventricular dysplasia, familial, 10. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Uniprot IDQ14126
Protein Accession #NP_001934
Nucleotide Accession #NM_001943
Protein Size (# AA)1118
Molecular Weight114kDa
Protein InteractionsUBC; SART3; EED; ADRB2; PAN2; CHCHD2; PLIN3; Trim69; Cbx1; RYK; PKP3; PKP2; JUP; DSC2; DSC1;
  1. What is the species homology for "DSG2 Antibody - N-terminal region : FITC (ARP45198_P050-FITC)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit".

  2. How long will it take to receive "DSG2 Antibody - N-terminal region : FITC (ARP45198_P050-FITC)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "DSG2 Antibody - N-terminal region : FITC (ARP45198_P050-FITC)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "DSG2 Antibody - N-terminal region : FITC (ARP45198_P050-FITC)"?

    This target may also be called "HDGC, CDHF5" in publications.

  5. What is the shipping cost for "DSG2 Antibody - N-terminal region : FITC (ARP45198_P050-FITC)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "DSG2 Antibody - N-terminal region : FITC (ARP45198_P050-FITC)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "DSG2 Antibody - N-terminal region : FITC (ARP45198_P050-FITC)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "114kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "DSG2 Antibody - N-terminal region : FITC (ARP45198_P050-FITC)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "DSG2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "DSG2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "DSG2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "DSG2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "DSG2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "DSG2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:DSG2 Antibody - N-terminal region : FITC (ARP45198_P050-FITC)
Your Rating
We found other products you might like!