Aviva Systems Biology office will be closed for Christmas and New Year Holiday - December 24-25, 2018 and January 1, 2019.
Please go here for more info.

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

DSG2 antibody - N-terminal region (ARP45198_P050)

100 ul
$319.00
In Stock

Conjugation Options

ARP45198_P050-FITC Conjugated

ARP45198_P050-HRP Conjugated

ARP45198_P050-Biotin Conjugated

Gene Symbol:
DSG2
NCBI Gene Id:
1829
Official Gene Full Name:
Desmoglein 2
Protein Name:
Desmoglein-2
Swissprot Id:
Q14126
Protein Accession #:
NP_001934
Nucleotide Accession #:
NM_001943
Alias Symbols:
ARVC10, ARVD10, CDHF5, HDGC, MGC117034, MGC117036, MGC117037, CMD1BB
Replacement Item:
This antibody may replace item sc-135815 from Santa Cruz Biotechnology.
Description of Target:
Desmosomes are cell-cell junctions between epithelial, myocardial, and certain other cell types. DSG2 is a calcium-binding transmembrane glycoprotein component of desmosomes in vertebrate epithelial cells. Currently, three desmoglein subfamily members have been identified and all are members of the cadherin cell adhesion molecule superfamily. These desmoglein gene family members are located in a cluster on chromosome 18. This second family member is expressed in colon, colon carcinoma, and other simple and stratified epithelial-derived cell lines.Desmosomes are cell-cell junctions between epithelial, myocardial, and certain other cell types. This gene product is a calcium-binding transmembrane glycoprotein component of desmosomes in vertebrate epithelial cells. Currently, three desmoglein subfamily members have been identified and all are members of the cadherin cell adhesion molecule superfamily. These desmoglein gene family members are located in a cluster on chromosome 18. This second family member is expressed in colon, colon carcinoma, and other simple and stratified epithelial-derived cell lines. Mutations in this gene have been associated with arrhythmogenic right ventricular dysplasia, familial, 10. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
1118
Molecular Weight:
114kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express DSG2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express DSG2.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human DSG2
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%
Complete computational species homology data:
Anti-DSG2 (ARP45198_P050)
Peptide Sequence:
Synthetic peptide located within the following region: KIHSDLAEERGLKITYKYTGKGITEPPFGIFVFNKDTGELNVTSILDREE
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; SART3; EED; ADRB2; PAN2; CHCHD2; PLIN3; Trim69; Cbx1; RYK; PKP3; PKP2; JUP; DSC2; DSC1;
Blocking Peptide:
For anti-DSG2 (ARP45198_P050) antibody is Catalog # AAP45198 (Previous Catalog # AAPP26187)
Datasheets/Manuals:
Printable datasheet for anti-DSG2 (ARP45198_P050) antibody
Additional Information:
IHC Information: Pancreas, Human: Formalin-Fixed, Paraffin-Embedded (FFPE)
IHC Information: Pancreas, Human: Formalin-Fixed, Paraffin-Embedded (FFPE)
Target Reference:
Cirillo,N., (2008) J. Cell. Biochem. 103 (2), 598-606
Publications:

Hummitzsch, K. et al. A new model of development of the mammalian ovary and follicles. PLoS One 8, e55578 (2013). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat 23409002

Tell us what you think about this item!

Write A Review
    Please, wait...