DRP-2 Antibody (Phospho-Thr514) (OAAF07653)

Catalog No: OAAF07653 (Formerly GWB-ASB569)

Size:100 ug

Western blot analysis of lysates from NIH/3T3 cells treated with PMA 125ng/ml 30', using DRP-2 (Phospho-Thr514) Antibody. The lane on the right is blocked with the phospho peptide.

Immunohistochemistry analysis of paraffin-embedded human brain, using DRP-2 (Phospho-Thr514) Antibody. The picture on the right is blocked with the phospho peptide.

Immunofluorescence analysis of HeLa cells, using DRP-2 (Phospho-Thr514) Antibody. The picture on the right is blocked with the phospho peptide.

Product Info

• Predicted Species Reactivity: Human|Mouse|Rat
• Clonality: Polyclonal
• Host: Rabbit
• Application: Enzyme-linked immunosorbent assay|Immunocytochemistry|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin|Western blot
• Additional Information: Modification Sites: Human:T514 Mouse:T514 Rat:T514
• Reconstitution and Storage: -20°C
• Immunogen: The antiserum was produced against synthesized peptide derived from human DRP-2 around the phosphorylation site of Thr514.
• Purification: The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.
• Peptide Sequence: Synthetic peptide located within the following region: KRIKARSRLAELRGVPRGLYDGPVCEVSVTPKTVTPASSAKTSPAKQQAP
• Concentration: 1mg/ml
• Specificity: DRP-2 (Phospho-Thr514) Antibody detects endogenous levels of DRP-2 only when phosphorylated at Thr514.
• Formulation: Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
• Application Info: WB: 1:500~1:1000
  IHC: 1:50~1:100
  IF: 1:100~1:500
  ELISA: 1:5000

Target Info

• Gene Symbol: DPYSL2
• Gene Full Name: dihydropyrimidinase like 2
• Alias Symbols: Collapsin response mediator protein 2;collapsin response mediator protein hCRMP-2;CRMP2;CRMP-2;DHPRP2;dihydropyrimidinase-related protein 2;DRP2;DRP-2;N2A3;ULIP2;ULIP-2;unc-33-like phosphoprotein 2.
• NCBI Gene Id: 1808
• Protein Name: Dihydropyrimidinase-related protein 2
• Description of Target: Plays a role in neuronal development and polarity, as well as in axon growth and guidance, neuronal growth cone collapse and cell migration. Necessary for signaling by class 3 semaphorins and subsequent remodeling of the cytoskeleton. May play a role in endocytosis.
• Uniprot ID: Q16555
• Molecular Weight: 62 kDa