Search Antibody, Protein, and ELISA Kit Solutions

DRD3 Antibody - N-terminal region (ARP88042_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
DRD3
Official Gene Full Name:
dopamine receptor D3
NCBI Gene Id:
1814
Protein Name:
D(3) dopamine receptor
Swissprot Id:
P35462-3
Protein Accession #:
NP_000787.2
Nucleotide Accession #:
NM_000796.5
Alias Symbols:
D3DR, ETM1, FET1
Description of Target:
This gene encodes the D3 subtype of the five (D1-D5) dopamine receptors. The activity of the D3 subtype receptor is mediated by G proteins which inhibit adenylyl cyclase. This receptor is localized to the limbic areas of the brain, which are associated with cognitive, emotional, and endocrine functions. Genetic variation in this gene may be associated with susceptibility to hereditary essential tremor 1. Alternative splicing of this gene results in transcript variants encoding different isoforms, although some variants may be subject to nonsense-mediated decay (NMD).
Protein Size (# AA):
367
Molecular Weight:
40 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express DRD3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express DRD3.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human DRD3
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: SSHLNYTCGAENSTGASQARPHAYYALSYCALILAIVFGNGLVCMAVLKE
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-DRD3 (ARP88042_P050) antibody is Catalog # AAP88042
Datasheets/Manuals:
Printable datasheet for anti-DRD3 (ARP88042_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...