Aviva Systems Biology will be closed in observance of Good Friday 3/29/2024. If you are in need of any assistance please email info@avivasysbio.com

Catalog No: ARP63162_P050
Price: $0.00
SKU
ARP63162_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

DRD3 Antibody - C-terminal region (ARP63162_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-DRD3 (ARP63162_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Rat, Cow, Dog, Guinea Pig, Horse, Pig
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 77%; Dog: 86%; Guinea Pig: 75%; Horse: 79%; Human: 100%; Pig: 79%; Rat: 86%
Peptide SequenceSynthetic peptide located within the following region: QERGGELKREEKTRNSLMPLREKKATQMVAIVLGAFIVCWLPFFLTHVLN
Concentration0.5 mg/ml
Blocking PeptideFor anti-DRD3 (ARP63162_P050) antibody is Catalog # AAP63162
Gene SymbolDRD3
Gene Full NameDopamine receptor D3
Alias SymbolsD3DR, ETM1, FET1
NCBI Gene Id1814
Protein NameD(3) dopamine receptor
Description of TargetThis gene encodes the D3 subtype of the five (D1-D5) dopamine receptors. The activity of the D3 subtype receptor is mediated by G proteins which inhibit adenylyl cyclase. This receptor is localized to the limbic areas of the brain, which are associated with cognitive, emotional, and endocrine functions. Genetic variation in this gene may be associated with susceptibility to hereditary essential tremor 1. Alternative splicing of this gene results in transcript variants encoding different isoforms, although some variants may be subject to nonsense-mediated decay (NMD).
Uniprot IDP35462
Protein Accession #NP_387512
Nucleotide Accession #NM_033663
Protein Size (# AA)367
Molecular Weight41kDa
Protein InteractionsSLC9A3; USP48; EEF1G; CLIC6; MPDZ; EPB41L2; GIPC1; NCS1; EPB41L1; EEF1B2; NCK1; FLNA; GNAI1; EPB41; GRB2; RDX;
  1. What is the species homology for "DRD3 Antibody - C-terminal region (ARP63162_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Rat, Cow, Dog, Guinea Pig, Horse, Pig".

  2. How long will it take to receive "DRD3 Antibody - C-terminal region (ARP63162_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "DRD3 Antibody - C-terminal region (ARP63162_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "DRD3 Antibody - C-terminal region (ARP63162_P050)"?

    This target may also be called "D3DR, ETM1, FET1" in publications.

  5. What is the shipping cost for "DRD3 Antibody - C-terminal region (ARP63162_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "DRD3 Antibody - C-terminal region (ARP63162_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "DRD3 Antibody - C-terminal region (ARP63162_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "41kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "DRD3 Antibody - C-terminal region (ARP63162_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "DRD3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "DRD3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "DRD3"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "DRD3"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "DRD3"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "DRD3"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:DRD3 Antibody - C-terminal region (ARP63162_P050)
Your Rating