Search Antibody, Protein, and ELISA Kit Solutions

DRD3 Antibody - C-terminal region (ARP63162_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP63162_P050-FITC Conjugated

ARP63162_P050-HRP Conjugated

ARP63162_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Pig, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Purification:
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 77%; Dog: 86%; Guinea Pig: 75%; Horse: 79%; Human: 100%; Pig: 79%; Rat: 86%
Complete computational species homology data:
Anti-DRD3 (ARP63162_P050)
Peptide Sequence:
Synthetic peptide located within the following region: QERGGELKREEKTRNSLMPLREKKATQMVAIVLGAFIVCWLPFFLTHVLN
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-DRD3 (ARP63162_P050) antibody is Catalog # AAP63162
Datasheets/Manuals:
Printable datasheet for anti-DRD3 (ARP63162_P050) antibody
Gene Symbol:
DRD3
Official Gene Full Name:
Dopamine receptor D3
Alias Symbols:
D3DR, ETM1, FET1, MGC149204, MGC149205
NCBI Gene Id:
1814
Protein Name:
D(3) dopamine receptor
Description of Target:
This gene encodes the D3 subtype of the five (D1-D5) dopamine receptors. The activity of the D3 subtype receptor is mediated by G proteins which inhibit adenylyl cyclase. This receptor is localized to the limbic areas of the brain, which are associated with cognitive, emotional, and endocrine functions. Genetic variation in this gene may be associated with susceptibility to hereditary essential tremor 1. Alternative splicing of this gene results in transcript variants encoding different isoforms, although some variants may be subject to nonsense-mediated decay (NMD).
Swissprot Id:
P35462
Protein Accession #:
NP_387512
Nucleotide Accession #:
NM_033663
Protein Size (# AA):
367
Molecular Weight:
41kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express DRD3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express DRD3.
Protein Interactions:
SLC9A3; USP48; EEF1G; CLIC6; MPDZ; EPB41L2; GIPC1; NCS1; EPB41L1; EEF1B2; NCK1; FLNA; GNAI1; EPB41; GRB2; RDX;

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...