Search Antibody, Protein, and ELISA Kit Solutions

DRD1 Antibody - N-terminal region (ARP63609_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP63609_P050-FITC Conjugated

ARP63609_P050-HRP Conjugated

ARP63609_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Pig, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-14001 from Santa Cruz Biotechnology.
Purification:
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 93%; Guinea Pig: 92%; Horse: 86%; Human: 100%; Pig: 93%; Rabbit: 93%; Rat: 100%
Complete computational species homology data:
Anti-DRD1 (ARP63609_P050)
Peptide Sequence:
Synthetic peptide located within the following region: AAFILISVAWTLSVLISFIPVQLSWHKAKPTSPSDGNATSLAETIDNCDS
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-DRD1 (ARP63609_P050) antibody is Catalog # AAP63609
Datasheets/Manuals:
Printable datasheet for anti-DRD1 (ARP63609_P050) antibody
Gene Symbol:
DRD1
Official Gene Full Name:
Dopamine receptor D1
Alias Symbols:
DADR, DRD1A
NCBI Gene Id:
1812
Protein Name:
D(1A) dopamine receptor
Description of Target:
This gene encodes the D1 subtype of the dopamine receptor. The D1 subtype is the most abundant dopamine receptor in the central nervous system. This G-protein coupled receptor stimulates adenylyl cyclase and activates cyclic AMP-dependent protein kinases. D1 receptors regulate neuronal growth and development, mediate some behavioral responses, and modulate dopamine receptor D2-mediated events.
Swissprot Id:
P21728
Protein Accession #:
NP_000785
Nucleotide Accession #:
NM_000794
Protein Size (# AA):
446
Molecular Weight:
49kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express DRD1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express DRD1.
Protein Interactions:
RANBP10; RANBP9; HRH3; GRIN1; DNAJC14; COPG1; EPB41L2; CALY; COPG2; CAV2; FLNA; ADORA1; ADA;

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...