Dr1 Antibody - middle region : HRP (ARP31272_P050-HRP)

Catalog No: ARP31272_P050-HRP

Size:100ul

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: HRP: Horseradish Peroxidase
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
• Peptide Sequence: Synthetic peptide located within the following region: KKTISPEHVIQALESLGFGSYISEVKEVLQECKTVALKRRKASSRLENLG
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-Dr1 (ARP31272_P050-HRP) antibody is Catalog # AAP31272

Target Info

• Gene Symbol: Dr1
• Gene Full Name: Down-regulator of transcription 1
• Alias Symbols: Dr, NC, NC2, Dr1l, NC2be, NC2beta, 1700121L09Rik
• NCBI Gene Id: 13486
• Protein Name: Protein Dr1
• Description of Target: The association of the DR1/DRAP1 heterodimer with TBP results in a functional repression of both activated and basal transcription of class II genes. This interaction precludes the formation of a transcription-competent complex by inhibiting the association of TFIIA and/or TFIIB with TBP. Dr1 can bind to DNA on its own. It is a component of the ATAC complex, a complex with histone acetyltransferase activity on histones H3 and H4.
• Uniprot ID: Q91WV0
• Protein Accession #: NP_080382
• Nucleotide Accession #: NM_026106
• Protein Size (# AA): 176
• Molecular Weight: 19kDa
• Protein Interactions: Csrp2bp;