Catalog No: ARP31272_P050-FITC
Size:100ul
Price: $499.00
SKU
ARP31272_P050-FITC
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

Dr1 Antibody - middle region : FITC (ARP31272_P050-FITC)

Datasheets/ManualsPrintable datasheet for anti-Dr1 (ARP31272_P050-FITC) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationFITC: Fluorescein Isothiocyanate
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Peptide SequenceSynthetic peptide located within the following region: KKTISPEHVIQALESLGFGSYISEVKEVLQECKTVALKRRKASSRLENLG
Concentration0.5 mg/ml
Blocking PeptideFor anti-Dr1 (ARP31272_P050-FITC) antibody is Catalog # AAP31272
Gene SymbolDr1
Gene Full NameDown-regulator of transcription 1
Alias SymbolsDr, NC, NC2, Dr1l, NC2be, NC2beta, 1700121L09Rik
NCBI Gene Id13486
Protein NameProtein Dr1
Description of TargetThe association of the DR1/DRAP1 heterodimer with TBP results in a functional repression of both activated and basal transcription of class II genes. This interaction precludes the formation of a transcription-competent complex by inhibiting the association of TFIIA and/or TFIIB with TBP. Dr1 can bind to DNA on its own. It is a component of the ATAC complex, a complex with histone acetyltransferase activity on histones H3 and H4.
Uniprot IDQ91WV0
Protein Accession #NP_080382
Nucleotide Accession #NM_026106
Protein Size (# AA)176
Molecular Weight19kDa
Protein InteractionsCsrp2bp;
  1. What is the species homology for "Dr1 Antibody - middle region : FITC (ARP31272_P050-FITC)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish".

  2. How long will it take to receive "Dr1 Antibody - middle region : FITC (ARP31272_P050-FITC)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "Dr1 Antibody - middle region : FITC (ARP31272_P050-FITC)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "Dr1 Antibody - middle region : FITC (ARP31272_P050-FITC)"?

    This target may also be called "Dr, NC, NC2, Dr1l, NC2be, NC2beta, 1700121L09Rik" in publications.

  5. What is the shipping cost for "Dr1 Antibody - middle region : FITC (ARP31272_P050-FITC)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "Dr1 Antibody - middle region : FITC (ARP31272_P050-FITC)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "Dr1 Antibody - middle region : FITC (ARP31272_P050-FITC)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "19kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "Dr1 Antibody - middle region : FITC (ARP31272_P050-FITC)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "DR1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "DR1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "DR1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "DR1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "DR1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "DR1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:Dr1 Antibody - middle region : FITC (ARP31272_P050-FITC)
Your Rating
We found other products you might like!