Dr1 Antibody - middle region (ARP31272_P050)

Catalog No: ARP31272_P050

WB Suggested Anti-Dr1 Antibody
Titration: 1.0 ug/ml
Positive Control: Mouse Kidney

Product Info

• Tested Species Reactivity: Mouse
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
• Peptide Sequence: Synthetic peptide located within the following region: KKTISPEHVIQALESLGFGSYISEVKEVLQECKTVALKRRKASSRLENLG
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-Dr1 (ARP31272_P050) antibody is Catalog # AAP31272

Target Info

• Gene Symbol: Dr1
• Gene Full Name: Down-regulator of transcription 1
• Alias Symbols: Dr, NC, NC2, Dr1l, NC2be, NC2beta, 1700121L09Rik
• NCBI Gene Id: 13486
• Protein Name: Protein Dr1
• Description of Target: The association of the DR1/DRAP1 heterodimer with TBP results in a functional repression of both activated and basal transcription of class II genes. This interaction precludes the formation of a transcription-competent complex by inhibiting the association of TFIIA and/or TFIIB with TBP. Dr1 can bind to DNA on its own. It is a component of the ATAC complex, a complex with histone acetyltransferase activity on histones H3 and H4.
• Uniprot ID: Q91WV0
• Protein Accession #: NP_080382
• Nucleotide Accession #: NM_026106
• Protein Size (# AA): 176
• Molecular Weight: 19kDa
• Protein Interactions: Csrp2bp;