DPP6 Antibody - middle region (ARP44868_P050)

Catalog No: ARP44868_P050

WB Suggested Anti-DPP6 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Muscle

Lanes:
Lane 1: 20ug mouse WT brain extract
Lnae 2: DPP6 -/- mouse brain extract
Lane 3: 20ug mouse WT brain extract
4: DPP6 -/- mouse brain extract
Primary Antibody Dilution:
1:1000
Secondary Antibody:
Donkey anti-rabbit-HRP
Secondary Antibody Dilution:
1:10,000
Gene Name:
DPP6 a
Submitted by:
Jeanne M. Nerbonne, Arvin Soepriatna, Washington University Medical School Department of Developmental Biology

Product Info

• Tested Species Reactivity: Human, Mouse
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DPP6
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
• Peptide Sequence: Synthetic peptide located within the following region: FLIIHPTADEKIHFQHTAELITQLIRGKANYSLQIYPDESHYFTSSSLKQ
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-DPP6 (ARP44868_P050) antibody is Catalog # AAP44868 (Previous Catalog # AAPP25947)
• Reference: Uhl,G.R., (2008) Arch. Gen. Psychiatry 65 (6), 683-693

Target Info

• Gene Symbol: DPP6
• Gene Full Name: Dipeptidyl-peptidase 6
• Alias Symbols: VF2, DPL1, DPPX, MRD33
• NCBI Gene Id: 1804
• Protein Name: Dipeptidyl aminopeptidase-like protein 6
• Description of Target: DPP6 is a single-pass type II membrane protein that is a member of the S9B family in clan SC of the serine proteases. This protein has no detectable protease activity, most likely due to the absence of the conserved serine residue normally present in the catalytic domain of serine proteases. However, it does bind specific voltage-gated potassium channels and alters their expression and biophysical properties.This gene encodes a single-pass type II membrane protein that is a member of the S9B family in clan SC of the serine proteases. This protein has no detectable protease activity, most likely due to the absence of the conserved serine residue normally present in the catalytic domain of serine proteases. However, it does bind specific voltage-gated potassium channels and alters their expression and biophysical properties. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
• Uniprot ID: P42658
• Protein Accession #: NP_001034439
• Nucleotide Accession #: NM_001039350
• Protein Size (# AA): 801
• Molecular Weight: 91kDa
• Protein Interactions: KCND2; PRNP;