Loading...
Catalog No: ARP63319_P050
Price: $0.00
SKU
ARP63319_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

DPP4 Antibody - C-terminal region (ARP63319_P050)

Rating:
100% of 100
Datasheets/ManualsPrintable datasheet for anti-DPP4 (ARP63319_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 100%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: DSVYTERYMGLPTPEDNLDHYRNSTVMSRAENFKQVEYLLIHGTADDNVH
Concentration0.5 mg/ml
Blocking PeptideFor anti-DPP4 (ARP63319_P050) antibody is Catalog # AAP63319
Publications

Upregulated expression and activation of membrane‑associated proteases in esophageal squamous cell carcinoma. Oncol Rep. 31, 2820-6 (2014). 24789592

Description
Gene SymbolDPP4
Gene Full NameDipeptidyl-peptidase 4
Alias SymbolsCD26, ADABP, ADCP2, DPPIV, TP103
NCBI Gene Id1803
Protein NameDipeptidyl peptidase 4
Description of TargetThe protein encoded by this gene is identical to adenosine deaminase complexing protein-2, and to the T-cell activation antigen CD26. It is an intrinsic membrane glycoprotein and a serine exopeptidase that cleaves X-proline dipeptides from the N-terminus of polypeptides.
Uniprot IDP27487
Protein Accession #NP_001926
Nucleotide Accession #NM_001935
Protein Size (# AA)766
Molecular Weight84kDa
Protein InteractionsDKK1; CARD11; BCL10; IKBKB; CPAMD8; GRP; CXCL11; CCL22; CXCL9; CCL3L1; CCL11; CXCL12; FAP; DPP4; CCL5; CD4; CXCR4; PTPRC; CXCL10; ADA;
  1. What is the species homology for "DPP4 Antibody - C-terminal region (ARP63319_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit".

  2. How long will it take to receive "DPP4 Antibody - C-terminal region (ARP63319_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "DPP4 Antibody - C-terminal region (ARP63319_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "DPP4 Antibody - C-terminal region (ARP63319_P050)"?

    This target may also be called "CD26, ADABP, ADCP2, DPPIV, TP103" in publications.

  5. What is the shipping cost for "DPP4 Antibody - C-terminal region (ARP63319_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "DPP4 Antibody - C-terminal region (ARP63319_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "DPP4 Antibody - C-terminal region (ARP63319_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "84kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "DPP4 Antibody - C-terminal region (ARP63319_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "DPP4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "DPP4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "DPP4"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "DPP4"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "DPP4"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "DPP4"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:DPP4 Antibody - C-terminal region (ARP63319_P050)
Your Rating
We found other products you might like!